KEGG   Homo sapiens (human): 3576Help
Entry
3576              CDS       T01001                                 

Gene name
CXCL8, GCP-1, GCP1, IL8, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05219  Bladder cancer
hsa05323  Rheumatoid arthritis
Network
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CXCR-GNB/G-PI3K-JNK signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00272  HCV NS5A to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    3576 (CXCL8)
   04072 Phospholipase D signaling pathway
    3576 (CXCL8)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3576 (CXCL8)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    3576 (CXCL8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3576 (CXCL8)
   04621 NOD-like receptor signaling pathway
    3576 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    3576 (CXCL8)
   04657 IL-17 signaling pathway
    3576 (CXCL8)
   04062 Chemokine signaling pathway
    3576 (CXCL8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3576 (CXCL8)
   05202 Transcriptional misregulation in cancers
    3576 (CXCL8)
   05219 Bladder cancer
    3576 (CXCL8)
  Immune diseases
   05323 Rheumatoid arthritis
    3576 (CXCL8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3576 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3576 (CXCL8)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3576 (CXCL8)
   05132 Salmonella infection
    3576 (CXCL8)
   05131 Shigellosis
    3576 (CXCL8)
   05133 Pertussis
    3576 (CXCL8)
   05134 Legionellosis
    3576 (CXCL8)
   05164 Influenza A
    3576 (CXCL8)
   05161 Hepatitis B
    3576 (CXCL8)
   05160 Hepatitis C
    3576 (CXCL8)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3576 (CXCL8)
   05146 Amoebiasis
    3576 (CXCL8)
   05144 Malaria
    3576 (CXCL8)
   05142 Chagas disease (American trypanosomiasis)
    3576 (CXCL8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   3576 (CXCL8)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
   3576 (CXCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 3576
NCBI-ProteinID: NP_000575
OMIM: 146930
HGNC: 6025
Ensembl: ENSG00000169429
Vega: OTTHUMG00000151316
Pharos: P10145(Tchem)
UniProt: P10145 A0A024RDA5
LinkDB All DBs
Structure
PDB: 

Position
4q13.3
AA seq 99 aa AA seqDB search
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacatac
tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaacacagaaattattgtaaagctttctgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggctgagaattcataa

DBGET integrated database retrieval system