KEGG   Homo sapiens (human): 3581Help
Entry
3581              CDS       T01001                                 

Gene name
IL9R, CD129, IL-9R
Definition
(RefSeq) interleukin 9 receptor
  KO
K05073  interleukin 9 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3581 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3581 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3581 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3581 (IL9R)
   04090 CD molecules [BR:hsa04090]
    3581 (IL9R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3581 (IL9R)
CD molecules [BR:hsa04090]
 Proteins
  3581 (IL9R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 3581
NCBI-ProteinID: NP_002177
OMIM: 300007
HGNC: 6030
Ensembl: ENSG00000124334
Vega: OTTHUMG00000022720
Pharos: Q01113(Tbio)
UniProt: Q01113
LinkDB All DBs
Position
Xq28 and Yq12
AA seq 521 aa AA seqDB search
MGLGRCIWEGWTLESEALRRDMGTWLLACICICTCVCLGVSVTGEGQGPRSRTFTCLTNN
ILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTI
TFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLS
YELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEER
YTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIFLLLTGPTYLLFKLSPRVKRI
FYQNVPSPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEPCVQEATALLT
CGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQEDWAPTSLTR
PAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQG
LETQQGVAWVLAGHCQRPGLHEDLQGMLLPSVLSKARSWTF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgggactgggcagatgcatctgggaaggctggaccttggagagtgaggccctgaggcga
gacatgggcacctggctcctggcctgcatctgcatctgcacctgtgtctgcttgggagtc
tctgtcacaggggaaggacaagggccaaggtctagaaccttcacctgcctcaccaacaac
attctcaggatcgattgccactggtctgccccagagctgggacagggctccagcccctgg
ctcctcttcaccagcaaccaggctcctggcggcacacataagtgcatcttgcggggcagt
gagtgcaccgtcgtgctgccacctgaggcagtgctcgtgccatctgacaatttcaccatc
actttccaccactgcatgtctgggagggagcaggtcagcctggtggacccggagtacctg
ccccggagacacgttaagctggacccgccctctgacttgcagagcaacatcagttctggc
cactgcatcctgacctggagcatcagtcctgccttggagccaatgaccacacttctcagc
tatgagctggccttcaagaagcaggaagaggcctgggagcaggcccagcacagggatcac
attgtcggggtgacctggcttatacttgaagcctttgagctggaccctggctttatccat
gaggccaggctgcgtgtccagatggccacactggaggatgatgtggtagaggaggagcgt
tatacaggccagtggagtgagtggagccagcctgtgtgcttccaggctccccagagacaa
ggccctctgatcccaccctgggggtggccaggcaacacccttgttgctgtgtccatcttt
ctcctgctgactggcccgacctacctcctgttcaagctgtcgcccagggtgaagagaatc
ttctaccagaacgtgccctctccagcgatgttcttccagcccctctacagtgtacacaat
gggaacttccagacttggatgggggcccacggggccggtgtgctgttgagccaggactgt
gctggcaccccacagggagccttggagccctgcgtccaggaggccactgcactgctcact
tgtggcccagcgcgtccttggaaatctgtggccctggaggaggaacaggagggccctggg
accaggctcccggggaacctgagctcagaggatgtgctgccagcagggtgtacggagtgg
agggtacagacgcttgcctatctgccacaggaggactgggcccccacgtccctgactagg
ccggctcccccagactcagagggcagcaggagcagcagcagcagcagcagcagcaacaac
aacaactactgtgccttgggctgctatgggggatggcacctctcagccctcccaggaaac
acacagagctctgggcccatcccagccctggcctgtggcctttcttgtgaccatcagggc
ctggagacccagcaaggagttgcctgggtgctggctggtcactgccagaggcctgggctg
catgaggacctccagggcatgttgctcccttctgtcctcagcaaggctcggtcctggaca
ttctag

DBGET integrated database retrieval system