KEGG   Homo sapiens (human): 3586Help
Entry
3586              CDS       T01001                                 

Gene name
IL10, CSIF, GVHDS, IL-10, IL10A, TGIF
Definition
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05330  Allograft rejection
Network
N00415  IL10-Jak-STAT signaling pathway
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H01227  Inflammatory bowel disease (IBD)
H01359  Anaphylaxis
H01466  Ulcerative colitis
H01468  Eosinophilic granulomatosis with polyangiitis
H01476  Behcet disease
Drug target
Pirfenidone: D01583
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3586 (IL10)
   04068 FoxO signaling pathway
    3586 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3586 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    3586 (IL10)
   04660 T cell receptor signaling pathway
    3586 (IL10)
   04672 Intestinal immune network for IgA production
    3586 (IL10)
 09160 Human Diseases
  09163 Immune diseases
   05310 Asthma
    3586 (IL10)
   05322 Systemic lupus erythematosus
    3586 (IL10)
   05320 Autoimmune thyroid disease
    3586 (IL10)
   05321 Inflammatory bowel disease (IBD)
    3586 (IL10)
   05330 Allograft rejection
    3586 (IL10)
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    3586 (IL10)
   05150 Staphylococcus aureus infection
    3586 (IL10)
   05152 Tuberculosis
    3586 (IL10)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    3586 (IL10)
   05144 Malaria
    3586 (IL10)
   05145 Toxoplasmosis
    3586 (IL10)
   05140 Leishmaniasis
    3586 (IL10)
   05142 Chagas disease (American trypanosomiasis)
    3586 (IL10)
   05143 African trypanosomiasis
    3586 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3586 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3586 (IL10)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3586 (IL10)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   3586 (IL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL10 IL22 TSA
Motif
Other DBs
NCBI-GeneID: 3586
NCBI-ProteinID: NP_000563
OMIM: 124092
HGNC: 5962
Ensembl: ENSG00000136634
Vega: OTTHUMG00000036386
Pharos: P22301(Tbio)
UniProt: P22301 Q6FGW4
LinkDB All DBs
Structure
PDB: 

Position
1q32.1
AA seq 178 aa AA seqDB search
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctcagcactgctctgttgcctggtcctcctgactggggtgagggccagccca
ggccagggcacccagtctgagaacagctgcacccacttcccaggcaacctgcctaacatg
cttcgagatctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag
ctggacaacttgttgttaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
caagacccagacatcaaggcgcatgtgaactccctgggggagaacctgaagaccctcagg
ctgaggctacggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtggag
caggtgaagaatgcctttaataagctccaagagaaaggcatctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaatgaagatacgaaactga

DBGET integrated database retrieval system