KEGG   Homo sapiens (human): 3590Help
Entry
3590              CDS       T01001                                 

Gene name
IL11RA, CRSDA
Definition
(RefSeq) interleukin 11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
Disease
H02254  Craniosynostosis and dental anomalies
Drug target
Oprelvekin: D05266
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3590 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3590 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3590 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3590 (IL11RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   3590 (IL11RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 ig Ig_2 EpoR_lig-bind I-set IL12p40_C
Motif
Other DBs
NCBI-GeneID: 3590
NCBI-ProteinID: NP_001136256
OMIM: 600939
HGNC: 5967
Ensembl: ENSG00000137070
Vega: OTTHUMG00000019837
Pharos: Q14626(Tclin)
UniProt: Q14626 Q5VZ79
LinkDB All DBs
Position
9p13.3
AA seq 422 aa AA seqDB search
MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWF
RDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHR
DSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAP
NL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggccgtggctacagccctggtg
tctgcctcctccccctgcccccaggcctggggccccccaggggtccagtatgggcagcca
ggcaggtccgtgaagctgtgttgtcctggagtgactgccggggacccagtgtcctggttt
cgggatggggagccaaagctgctccagggacctgactctgggctagggcatgaactggtc
ctggcccaggcagacagcactgatgagggcacctacatctgccagaccctggatggtgca
cttgggggcacagtgaccctgcagctgggctaccctccagcccgccctgttgtctcctgc
caagcagccgactatgagaacttctcttgcacttggagtcccagccagatcagcggttta
cccacccgctacctcacctcctacaggaagaagacagtcctaggagctgatagccagagg
aggagtccatccacagggccctggccatgcccacaggatcccctaggggctgcccgctgt
gttgtccacggggctgagttctggagccagtaccggattaatgtgactgaggtgaaccca
ctgggtgccagcacacgcctgctggatgtgagcttgcagagcatcttgcgccctgaccca
ccccagggcctgcgggtagagtcagtaccaggttacccccgacgcctgcgagccagctgg
acataccctgcctcctggccgtgccagccccacttcctgctcaagttccgtttgcagtac
cgtccggcgcagcatccagcctggtccacggtggagccagctggactggaggaggtgatc
acagatgctgtggctgggctgccccatgctgtacgagtcagtgcccgggactttctagat
gctggcacctggagcacctggagcccggaggcctggggaactccgagcactgggaccata
ccaaaggagataccagcatggggccagctacacacgcagccagaggtggagcctcaggtg
gacagccctgctcctccaaggccctccctccaaccacaccctcggctacttgatcacagg
gactctgtggagcaggtagctgtgctggcgtctttgggaatcctttctttcctgggactg
gtggctggggccctggcactggggctctggctgaggctgagacggggtgggaaggatgga
tccccaaagcctgggttcttggcctcagtgattccagtggacaggcgtccaggagctcca
aacctgtag

DBGET integrated database retrieval system