KEGG   Homo sapiens (human): 3595Help
Entry
3595              CDS       T01001                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin 12 receptor subunit beta 2
  KO
K05064  interleukin 12 receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H01476  Behcet disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3595 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3595 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3595 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3595 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    3595 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3595 (IL12RB2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   3595 (IL12RB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind Tissue_fac EpoR_lig-bind
Motif
Other DBs
NCBI-GeneID: 3595
NCBI-ProteinID: NP_001550
OMIM: 601642
HGNC: 5972
Ensembl: ENSG00000081985
Vega: OTTHUMG00000009094
Pharos: Q99665(Tbio)
UniProt: Q99665
LinkDB All DBs
Position
1p31.3
AA seq 862 aa AA seqDB search
MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCF
HYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFV
GVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDY
LDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVS
RCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHY
QVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAG
LLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYN
VSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILIS
WNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTA
LTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAALRPQ
WCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRH
PPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPE
NPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPL
TFSCGDKLTLDQLKMRCDSLML
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggcacatacttttagaggatgctcattggcatttatgtttataatcacgtggctgttg
attaaagcaaaaatagatgcgtgcaagagaggcgatgtgactgtgaagccttcccatgta
attttacttggatccactgtcaatattacatgctctttgaagcccagacaaggctgcttt
cactattccagacgtaacaagttaatcctgtacaagtttgacagaagaatcaattttcac
catggccactccctcaattctcaagtcacaggtcttccccttggtacaaccttgtttgtc
tgcaaactggcctgtatcaatagtgatgaaattcaaatatgtggagcagagatcttcgtt
ggtgttgctccagaacagcctcaaaatttatcctgcatacagaagggagaacaggggact
gtggcctgcacctgggaaagaggacgagacacccacttatacactgagtatactctacag
ctaagtggaccaaaaaatttaacctggcagaagcaatgtaaagacatttattgtgactat
ttggactttggaatcaacctcacccctgaatcacctgaatccaatttcacagccaaggtt
actgctgtcaatagtcttggaagctcctcttcacttccatccacattcacattcttggac
atagtgaggcctcttcctccgtgggacattagaatcaaatttcaaaaggcttctgtgagc
agatgtaccctttattggagagatgagggactggtactgcttaatcgactcagatatcgg
cccagtaacagcaggctctggaatatggttaatgttacaaaggccaaaggaagacatgat
ttgctggatctgaaaccatttacagaatatgaatttcagatttcctctaagctacatctt
tataagggaagttggagtgattggagtgaatcattgagagcacaaacaccagaagaagag
cctactgggatgttagatgtctggtacatgaaacggcacattgactacagtagacaacag
atttctcttttctggaagaatctgagtgtctcagaggcaagaggaaaaattctccactat
caggtgaccttgcaggagctgacaggagggaaagccatgacacagaacatcacaggacac
acctcctggaccacagtcattcctagaaccggaaattgggctgtggctgtgtctgcagca
aattcaaaaggcagttctctgcccactcgtattaacataatgaacctgtgtgaggcaggg
ttgctggctcctcgccaggtctctgcaaactcagagggcatggacaacattctggtgact
tggcagcctcccaggaaagatccctctgctgttcaggagtacgtggtggaatggagagag
ctccatccagggggtgacacacaggtccctctaaactggctacggagtcgaccctacaat
gtgtctgctctgatttcagagaacataaaatcctacatctgttatgaaatccgtgtgtat
gcactctcaggggatcaaggaggatgcagctccatcctgggtaactctaagcacaaagca
ccactgagtggcccccacattaatgccatcacagaggaaaaggggagcattttaatttca
tggaacagcattccagtccaggagcaaatgggctgcctcctccattataggatatactgg
aaggaacgggactccaactcccagcctcagctctgtgaaattccctacagagtctcccaa
aattcacatccaataaacagcctgcagccccgagtgacatatgtcctgtggatgacagct
ctgacagctgctggtgaaagttcccacggaaatgagagggaattttgtctgcaaggtaaa
gccaattggatggcgtttgtggcaccaagcatttgcattgctatcatcatggtgggcatt
ttctcaacgcattacttccagcaaaaggtgtttgttctcctagcagccctcagacctcag
tggtgtagcagagaaattccagatccagcaaatagcacttgcgctaagaaatatcccatt
gcagaggagaagacacagctgcccttggacaggctcctgatagactggcccacgcctgaa
gatcctgaaccgctggtcatcagtgaagtccttcatcaagtgaccccagttttcagacat
cccccctgctccaactggccacaaagggaaaaaggaatccaaggtcatcaggcctctgag
aaagacatgatgcacagtgcctcaagcccaccacctccaagagctctccaagctgagagc
agacaactggtggatctgtacaaggtgctggagagcaggggctccgacccaaagcccgaa
aacccagcctgtccctggacggtgctcccagcaggtgaccttcccacccatgatggctac
ttaccctccaacatagatgacctcccctcacatgaggcacctctcgctgactctctggaa
gaactggagcctcagcacatctccctttctgttttcccctcaagttctcttcacccactc
accttctcctgtggtgataagctgactctggatcagttaaagatgaggtgtgactccctc
atgctctga

DBGET integrated database retrieval system