KEGG   Homo sapiens (human): 3596Help
Entry
3596              CDS       T01001                                 

Gene name
IL13, IL-13, P600
Definition
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04664  Fc epsilon RI signaling pathway
hsa05200  Pathways in cancer
hsa05310  Asthma
hsa05321  Inflammatory bowel disease (IBD)
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00079  Asthma
H00084  Graft-versus-host disease
H01358  Atopic dermatitis
H01360  Allergic rhinitis
Drug target
Anrukinzumab: D08857
Lebrikizumab: D09633
Romilkimab: D11598
Tralokinumab: D09979
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3596 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3596 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3596 (IL13)
   04657 IL-17 signaling pathway
    3596 (IL13)
   04664 Fc epsilon RI signaling pathway
    3596 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3596 (IL13)
  09163 Immune disease
   05310 Asthma
    3596 (IL13)
   05321 Inflammatory bowel disease (IBD)
    3596 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3596 (IL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3596 (IL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL13
Motif
Other DBs
NCBI-GeneID: 3596
NCBI-ProteinID: NP_002179
OMIM: 147683
HGNC: 5973
Ensembl: ENSG00000169194
Vega: OTTHUMG00000059723
Pharos: P35225(Tbio)
UniProt: P35225
LinkDB All DBs
Structure
PDB: 

Position
5q31.1
AA seq 146 aa AA seqDB search
MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP
LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD
TKIEVAQFVKDLLLHLKKLFREGQFN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgctcctcaatcctctcctgttggcactgggcctcatggcgcttttgttgacc
acggtcattgctctcacttgccttggcggctttgcctccccaggccctgtgcctccctct
acagccctcagggagctcattgaggagctggtcaacatcacccagaaccagaaggctccg
ctctgcaatggcagcatggtatggagcatcaacctgacagctggcatgtactgtgcagcc
ctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg
agcggattctgcccgcacaaggtctcagctgggcagttttccagcttgcatgtccgagac
accaaaatcgaggtggcccagtttgtaaaggacctgctcttacatttaaagaaacttttt
cgcgagggacagttcaactga

DBGET integrated database retrieval system