KEGG   Homo sapiens (human): 36
Entry
36                CDS       T01001                                 

Gene name
ACADSB, 2-MEBCAD, ACAD7, SBCAD
Definition
(RefSeq) acyl-CoA dehydrogenase short/branched chain
  KO
K09478  short/branched chain acyl-CoA dehydrogenase [EC:1.3.99.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Network
nt06020  beta-Oxidation in mitochondria
nt06024  Valine, leucine and isoleucine degradation
  Element
N00766  HADHB deficiency in beta-oxidation
N00767  HADH deficiency in beta-oxidation
N00775  HADHA deficiency in beta-oxidation
N00804  beta-Oxidation
N00856  Isoleucine degradation
N00857  HSD17B10 deficiency in isoleucine degradation
N00858  ACADSB deficiency in isoleucine degradation
Disease
H00375  SBCAD deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    36 (ACADSB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    36 (ACADSB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.12  2-methylacyl-CoA dehydrogenase
     36 (ACADSB)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M
Other DBs
NCBI-GeneID: 36
NCBI-ProteinID: NP_001600
OMIM: 600301
HGNC: 91
Ensembl: ENSG00000196177
Vega: OTTHUMG00000019200
Pharos: P45954(Tbio)
UniProt: P45954 A0A0S2Z3P9
LinkDB
Structure
PDB: 
2JIF

Position
10q26.13
AA seq 432 aa
MEGLAVRLLRGSRLLRRNFLTCLSSWKIPPHVSKSSQSEALLNITNNGIHFAPLQTFTDE
EMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLS
TVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAG
AGSDSFALKTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGITSFLVDRD
TPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQ
MLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNAARLLEAG
KPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQ
LNTIAKHIDAEY
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggagggcctggcagtgcggttgctgcgcggcagcaggctgctaagaagaaatttcctg
acttgtttgtcttcttggaagattcctcctcatgtctcaaaatcttcccagtcagaagct
ctactcaatataacaaataatggaatacactttgctcccctgcaaacatttacagatgag
gaaatgatgataaagagttcagttaaaaaatttgctcaggaacaaattgcacctttggtt
tcaaccatggatgaaaattcgaaaatggagaaatcagtaatacaaggattatttcaacaa
gggttgatgggtattgaagttgacccagaatatggaggcacaggagcttcatttttatcc
actgtgctcgtgatagaggaattagccaaagttgatgcatctgtggctgtcttttgtgag
atccagaacacattaattaacacactgattagaaaacatggaacagaagaacaaaaggcc
acctatttgcctcagctcactacagaaaaagtaggaagtttctgcctttcagaggctgga
gcaggtagtgactcatttgctttgaagaccagagctgataaagagggagattattatgtc
ctcaatggatcaaagatgtggatcagcagtgctgagcacgcagggctctttctggtgatg
gcaaatgtagaccctaccattggatataagggaattacctccttcttagtagatcgtgat
actccgggccttcatatagggaaacctgaaaacaaattggggctcagagcttcttccacc
tgcccgttaacattcgaaaatgtcaaggttccagaagccaatatcttgggacaaattgga
catggctataagtatgccatagggagtctcaatgaaggtagaataggaattgctgcacag
atgctgggactggcgcaaggatgttttgactacactattccatatattaaagaaaggata
caatttggcaaaagactatttgattttcagggcctccaacaccaagtggctcacgtggcc
acccagctggaagctgcaagattactaacatacaatgctgctaggcttttagaagctgga
aagccattcataaaagaagcgtcaatggccaaatactatgcatcagagattgcaggacaa
acaacgagtaaatgtatcgagtggatggggggagtaggctacaccaaagattaccctgtg
gagaaatacttccgagatgcaaagattggtacgatatatgaaggagcttccaacatccag
ttgaacaccattgcaaagcatatcgatgcagaatactga

DBGET integrated database retrieval system