KEGG   Homo sapiens (human): 360
Entry
360               CDS       T01001                                 

Gene name
AQP3, AQP-3, GIL
Definition
(RefSeq) aquaporin 3 (Gill blood group)
  KO
K09876  aquaporin-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    360 (AQP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    360 (AQP3)
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    360 (AQP3)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 360
NCBI-ProteinID: NP_004916
OMIM: 600170
HGNC: 636
Ensembl: ENSG00000165272
Vega: OTTHUMG00000019769
Pharos: Q92482(Tbio)
UniProt: Q92482
LinkDB
Position
9p13.3
AA seq 292 aa
MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN
LAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVF
GLYYDAIWHFADNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVD
PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQ
HWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI
NT seq 879 nt   +upstreamnt  +downstreamnt
atgggtcgacagaaggagctggtgtcccgctgcggggagatgctccacatccgctaccgg
ctgctccgacaggcgctggccgagtgcctggggaccctcatcctggtgatgtttggctgt
ggctccgtggcccaggttgtgctcagccggggcacccacggtggtttcctcaccatcaac
ctggcctttggctttgctgtcactctgggcatcctcatcgctggccaggtctctggggcc
cacctgaaccctgccgtgacctttgccatgtgcttcctggctcgtgagccctggatcaag
ctgcccatctacaccctggcacagacgctgggagccttcttgggtgctggaatagttttt
gggctgtattatgatgcaatctggcacttcgccgacaaccagctttttgtttcgggcccc
aatggcacagccggcatctttgctacctacccctctggacacttggatatgatcaatggc
ttctttgaccagttcataggcacagcctcccttatcgtgtgtgtgctggccattgttgac
ccctacaacaaccccgtcccccgaggcctggaggccttcaccgtgggcctggtggtcctg
gtcattggcacctccatgggcttcaactccggctatgccgtcaaccctgcccgggacttt
ggcccccgcctttttacagcccttgcgggctggggctctgcagtcttcacgaccggccag
cattggtggtgggtgcccatcgtgtccccactcctgggctccattgcgggtgtcttcgtg
taccagctgatgatcggctgccacctggagcagcccccaccctccaacgaggaagagaat
gtgaagctggcccatgtgaagcacaaggagcagatctga

DBGET integrated database retrieval system