KEGG   Homo sapiens (human): 360200Help
Entry
360200            CDS       T01001                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane serine protease 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    360200 (TMPRSS9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     360200 (TMPRSS9)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   360200 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 360200
NCBI-ProteinID: NP_892018
OMIM: 610477
HGNC: 30079
Ensembl: ENSG00000178297
Vega: OTTHUMG00000180431
Pharos: Q7Z410(Tdark)
UniProt: Q7Z410 Q0X0F2
LinkDB All DBs
Position
19p13.3
AA seq 1059 aa AA seqDB search
MEPTVADVHLVPRTTKEVPALDAACCRAASIGVVATSLVVLTLGVLLAFLSTQGFHVDHT
AELRGIRWTSSLRRETSDYHRTLTPTLEALLHFLLRPLQTLSLGLEEELLQRGIRARLRE
HGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECDDQEDC
SDGSDEAHCECGLQPAWRMAGRIVGGMEASPGEFPWQASLRENKEHFCGAAIINARWLVS
AAHCFNEFQDPTKWVAYVGATYLSGSEASTVRAQVVQIVKHPLYNADTADFDVAVLELTS
PLPFGRHIQPVCLPAATHIFPPSKKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCAS
LYGHSLTDRMVCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGV
YARVTRLRDWILEATTKASMPLAPTMAPAPAAPSTAWPTSPESPVVSTPTKSMQALSTVP
LDWVTVPKLQECGARPAMEKPTRVVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLL
SAAHCFNHTKVEQVRAHLGTASLLGLGGSPVKIGLRRVVLHPLYNPGILDFDLAVLELAS
PLAFNKYIQPVCLPLAIQKFPVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSV
LYNFSLTDRMICAGFLEGKVDSCQGDSGGPLACEEAPGVFYLAGIVSWGIGCAQVKKPGV
YTRITRLKGWILEIMSSQPLPMSPPSTTRMLATTSPRTTAGLTVPGATPSRPTPGAASRV
TGQPANSTLSAVSTTARGQTPFPDAPEATTHTQLPDCGLAPAALTRIVGGSAAGRGEWPW
QVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGAEGQLERVAR
IYKHPFYNLYTLDYDVALLELAGPVRRSRLVRPICLPEPAPRPPDGTRCVITGWGSVREG
GSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSG
RWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQHIQE
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atggagcccactgtggctgacgtacacctcgtgcccaggacaaccaaggaagtccccgct
ctggatgccgcgtgctgtcgagcggccagcattggcgtggtggccaccagccttgtcgtc
ctcaccctgggagtccttttggccttcctctctacacagggcttccacgtggaccacacg
gccgagctgcggggaatccggtggaccagcagtttgcggcgggagacctcggactatcac
cgcacgctgacgcccaccctggaggcactgctgcactttctgctgcgacccctccagacg
ctgagcctgggcctggaggaggagctattgcagcgagggatccgggcaaggctgcgggag
cacggcatctccctggctgcctatggcacaattgtgtcggctgagctcacagggagacat
aagggacccttggcagaaagagacttcaaatcaggccgctgtccagggaactccttttcc
tgcgggaacagccagtgtgtgaccaaggtgaacccggagtgtgacgaccaggaggactgc
tccgatgggtccgacgaggcgcactgcgagtgtggcttgcagcctgcctggaggatggcc
ggcaggatcgtgggcggcatggaagcatccccgggggagtttccgtggcaagccagcctt
cgagagaacaaggagcacttctgtggggccgccatcatcaacgccaggtggctggtgtct
gctgctcactgcttcaatgagttccaagacccgacgaagtgggtggcctacgtgggtgcg
acctacctcagcggctcggaggccagcaccgtgcgggcccaggtggtccagatcgtcaag
caccccctgtacaacgcggacacggccgactttgacgtggctgtgctggagctgaccagc
cctctgcctttcggccggcacatccagcccgtgtgcctcccggctgccacacacatcttc
ccacccagcaagaagtgcctgatctcaggctggggctacctcaaggaggacttcctggtc
aagccagaggtgctgcagaaagccactgtggagctgctggaccaggcactgtgtgccagc
ttgtacggccattcactcactgacaggatggtgtgcgctggctacctggacgggaaggtg
gactcctgccagggtgactcaggaggacccctggtctgcgaggagccctctggccggttc
tttctggctggcatcgtgagctggggaatcgggtgtgcggaagcccggcgtccaggggtc
tatgcccgagtcaccaggctacgtgactggatcctggaggccaccaccaaagccagcatg
cctctggcccccaccatggctcctgcccctgccgcccccagcacagcctggcccaccagt
cctgagagccctgtggtcagcacccccaccaaatcgatgcaggccctcagtaccgtgcct
cttgactgggtcaccgttcctaagctacaagaatgtggggccaggcctgcaatggagaag
cccacccgggtcgtgggcgggttcggagctgcctccggggaggtgccctggcaggtcagc
ctgaaggaagggtcccggcacttctgcggagcaactgtggtgggggaccgctggctgctg
tctgccgcccactgcttcaaccacacgaaggtggagcaggttcgggcccacctgggcact
gcgtccctcctgggcctgggcgggagcccggtgaagatcgggctgcggcgggtagtgctg
caccccctctacaaccctggcatcctggacttcgacctggctgtcctggagctggccagc
cccctggccttcaacaaatacatccagcctgtctgcctgcccctggccatccagaagttc
cctgtgggccggaagtgcatgatctccggatggggaaatacgcaggaaggaaatgccacc
aagcccgagctcctgcagaaggcgtccgtgggcatcatagaccagaaaacctgtagtgtg
ctctacaacttctccctcacagaccgcatgatctgcgcaggcttcctggaaggcaaagtc
gactcctgccagggtgactctgggggccccctggcctgcgaggaggcccctggcgtgttt
tatctggcagggatcgtgagctggggtattggctgcgctcaggttaagaagccgggcgtg
tacacgcgcatcaccaggctaaagggctggatcctggagatcatgtcctcccagcccctt
cccatgtctcccccctcgaccacaaggatgctggccaccaccagccccaggacgacagct
ggcctcacagtcccgggggccacacccagcagacccacccctggggctgccagcagggtg
acgggccaacctgccaactcaaccttatctgccgtgagcaccactgctaggggacagacg
ccatttccagacgccccggaggccaccacacacacccagctaccagactgtggcctggcg
ccggccgcgctcaccaggattgtgggcggcagcgcagcgggccgtggggagtggccgtgg
caggtgagcctgtggctgcggcgccgggaacaccgttgcggggccgtgctggtggcagag
aggtggctgctgtcggcggcgcactgcttcgacgtctacggggaccccaagcagtgggcg
gccttcctaggcacgccgttcctgagcggcgcggaggggcagctggagcgcgtggcgcgc
atctacaagcacccgttctacaatctctacacgctcgactacgacgtggcgctgctggag
ctggcggggccggtgcgtcgcagccgcctggtgcgtcccatctgcctgcccgagcccgcg
ccgcgacccccggacggcacgcgctgcgtcatcaccggctggggctcggtgcgcgaagga
ggctccatggcgcggcagctgcagaaggcggccgtgcgcctcctcagcgagcagacctgc
cgccgcttctacccagtgcagatcagcagccgcatgctgtgtgccggcttcccgcagggt
ggcgtggacagctgctcgggtgacgctgggggacccctggcctgcagggagccctctgga
cggtgggtgctaactggggtcactagctggggctatggctgtggccggccccacttccca
ggtgtctatacccgggtggcagctgtgagaggctggataggacagcacatccaggagtga

DBGET integrated database retrieval system