KEGG   Homo sapiens (human): 361
Entry
361               CDS       T01001                                 

Gene name
AQP4, MIWC, WCH4
Definition
(RefSeq) aquaporin 4
  KO
K09866  aquaporin-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa04976  Bile secretion
Disease
H01491  Neuromyelitis optica
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    361 (AQP4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    361 (AQP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    361 (AQP4)
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    361 (AQP4)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 361
NCBI-ProteinID: NP_001641
OMIM: 600308
HGNC: 637
Ensembl: ENSG00000171885
Vega: OTTHUMG00000131955
Pharos: P55087(Tbio)
UniProt: P55087 F1DSG4
LinkDB
Structure
PDB: 
3GD8

Position
18q11.2
AA seq 323 aa
MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWG
GTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIA
AQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDS
KRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG
AVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVH
VIDVDRGEEKKGKDQSGEVLSSV
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagtgacagacccacagcaaggcggtggggtaagtgtggacctttgtgtaccagagag
aacatcatggtggctttcaaaggggtctggactcaagctttctggaaagcagtcacagcg
gaatttctggccatgcttatttttgttctcctcagcctgggatccaccatcaactggggt
ggaacagaaaagcctttaccggtcgacatggttctcatctccctttgctttggactcagc
attgcaaccatggtgcagtgctttggccatatcagcggtggccacatcaaccctgcagtg
actgtggccatggtgtgcaccaggaagatcagcatcgccaagtctgtcttctacatcgca
gcccagtgcctgggggccatcattggagcaggaatcctctatctggtcacacctcccagt
gtggtgggaggcctgggagtcaccatggttcatggaaatcttaccgctggtcatggtctc
ctggttgagttgataatcacatttcaattggtgtttactatctttgccagctgtgattcc
aaacggactgatgtcactggctcaatagctttagcaattggattttctgttgcaattgga
catttatttgcaatcaattatactggtgccagcatgaatcccgcccgatcctttggacct
gcagttatcatgggaaattgggaaaaccattggatatattgggttgggcccatcatagga
gctgtcctcgctggtggcctttatgagtatgtcttctgtccagatgttgaattcaaacgt
cgttttaaagaagccttcagcaaagctgcccagcaaacaaaaggaagctacatggaggtg
gaggacaacaggagtcaggtagagacggatgacctgattctaaaacctggagtggtgcat
gtgattgacgttgaccggggagaggagaagaaggggaaagaccaatctggagaggtattg
tcttcagtatga

DBGET integrated database retrieval system