KEGG   Homo sapiens (human): 3632
Entry
3632              CDS       T01001                                 

Gene name
INPP5A, 5PTASE
Definition
(RefSeq) inositol polyphosphate-5-phosphatase A
  KO
K01106  inositol polyphosphate 5-phosphatase INPP5A [EC:3.1.3.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04910  Insulin signaling pathway
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3632 (INPP5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    3632 (INPP5A)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    3632 (INPP5A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     3632 (INPP5A)
SSDB
Motif
Pfam: Exo_endo_phos Glyco_hydro_cc OLF
Other DBs
NCBI-GeneID: 3632
NCBI-ProteinID: NP_005530
OMIM: 600106
HGNC: 6076
Ensembl: ENSG00000068383
Vega: OTTHUMG00000019293
Pharos: Q14642(Tbio)
UniProt: Q14642
LinkDB
Position
10q26.3
AA seq 412 aa
MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKN
YEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQF
DFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDL
VNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSK
SVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGT
ALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKEL
VLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcggggaaggcggccgccccgggcaccgcggtgctgctggtcacggccaacgtgggc
tcgctcttcgacgacccagaaaacctgcagaagaactggcttcgggaattttaccaggtc
gtgcacacacacaagccgcacttcatggccttgcactgtcaggagtttggagggaagaac
tacgaggcctccatgtcccacgtggacaagttcgtcaaagaactattgtcgagtgatgcg
atgaaagaatataacagggctcgagtctacctggatgaaaactacaaatcccaggagcac
ttcacggcactaggaagcttttattttcttcatgagtccttaaaaaacatctaccagttt
gactttaaagctaagaagtatagaaaggtcgctggcaaagagatctactcggatacctta
gagagcacgcccatgctggagaaggagaagtttccgcaggactacttccccgagtgcaaa
tggtcaagaaaaggcttcatccggacgaggtggtgcattgcagactgtgcctttgacttg
gtgaatatccatcttttccatgatgcttccaatctggtcgcctgggaaacaagcccttcc
gtgtactcgggaatccggcacaaggcactgggctacgtgctggacagaatcattgatcag
cgattcgagaaggtttcctactttgtatttggtgatttcaacttccggctggattccaag
tccgtcgtggagacgctctgcacaaaagccaccatgcagacggtccgggccgccgacacc
aatgaagtggtgaagctcatatttcgtgagtcggacaacgaccggaaggttatgctccag
ttagaaaagaaactcttcgactacttcaaccaggaggttttccgagacaacaacggcacc
gcgctcttggagtttgacaaggagttgtctgtctttaaggacagactgtatgaactggac
atctcgttccctcccagctacccgtacagtgaggacgcccgccagggtgagcagtacatg
aacacccggtgcccagcctggtgtgaccgcatcctcatgtccccgtctgccaaggagctg
gtgctgcggtcggagagcgaggagaaggttgtcacctatgaccacattgggcccaacgtc
tgcatgggagaccacaagcccgtgttcctggccttccgaatcatgcccggggcaggtaaa
cctcatgcccatgtgcacaagtgttgtgtcgtgcagtga

DBGET integrated database retrieval system