KEGG   Homo sapiens (human): 3640Help
Entry
3640              CDS       T01001                                 

Gene name
INSL3, RLF, RLNL, ley-I-L
Definition
(RefSeq) insulin like 3
  KO
K21999  insulin-like 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Disease
H02176  Cryptorchidism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3640 (INSL3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    3640 (INSL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Insulin Rrp40_N
Motif
Other DBs
NCBI-GeneID: 3640
NCBI-ProteinID: NP_005534
OMIM: 146738
HGNC: 6086
Ensembl: ENSG00000248099
Vega: OTTHUMG00000183481
Pharos: P51460(Tbio)
CPD: C16124
UniProt: P51460
LinkDB All DBs
Position
19p13.11
AA seq 131 aa AA seqDB search
MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAT
GGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGC
TQQDLLTLCPY
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggacccccgtctgcccgcctgggcgctggtgctgctgggccctgccctggtgttcgcg
ttgggccccgcgcccaccccagagatgcgtgagaagttgtgcggccaccacttcgtacgc
gcgctagtgcgcgtgtgcgggggcccccgctggtccaccgaagccaggaggcctgcgacc
ggaggcgaccgtgagttgctacagtggctggagagacgacatctgctccatgggctggtg
gccgacagtaatctcacgctgggacctggcctgcagcccctgccccagacctctcaccat
caccgccaccaccgtgcagctgccaccaaccctgcacgctactgctgcctcagtggctgt
acccaacaagacctgctgaccctctgtccctactga

DBGET integrated database retrieval system