KEGG   Homo sapiens (human): 3655
Entry
3655              CDS       T01001                                 

Gene name
ITGA6, CD49f, ITGA6B, VLA-6
Definition
(RefSeq) integrin subunit alpha 6
  KO
K06485  integrin alpha 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa05145  Toxoplasmosis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
Disease
H00586  Epidermolysis bullosa, junctional
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3655 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3655 (ITGA6)
   04514 Cell adhesion molecules
    3655 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3655 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3655 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3655 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3655 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3655 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    3655 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    3655 (ITGA6)
   05414 Dilated cardiomyopathy
    3655 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3655 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3655 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3655 (ITGA6)
   04515 Cell adhesion molecules [BR:hsa04515]
    3655 (ITGA6)
   04090 CD molecules [BR:hsa04090]
    3655 (ITGA6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3655 (ITGA6)
  Exosomal proteins of breast milk
   3655 (ITGA6)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3655 (ITGA6)
CD molecules [BR:hsa04090]
 Proteins
  3655 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Other DBs
NCBI-GeneID: 3655
NCBI-ProteinID: NP_001073286
OMIM: 147556
HGNC: 6142
Ensembl: ENSG00000091409
Vega: OTTHUMG00000132277
Pharos: P23229(Tbio)
UniProt: P23229
LinkDB
Position
2q31.1
AA seq 1091 aa
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTK
PTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggccgccgccgggcagctgtgcttgctctacctgtcggcggggctcctgtcccggctc
ggcgcagccttcaacttggacactcgggaggacaacgtgatccggaaatatggagacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgctcgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaacg
ggagggctgtacagctgcgacatcaccgcccgggggccatgcacgcggatcgagtttgat
aacgatgctgaccccacgtcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagtcagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttataactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgagcatgatgaaagtctcgttcctgttcctgctaacagttacttaggtttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctgaagagagacatgaagtctgcacat
ctcctccctgagcacatattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtgaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctccg
tatgatgacttgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
ccaacacaggttctcaagggtatatcaccttattttggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaatattcagaaaaccatcacagtaactcctaacaga
attgacctccgccagaaaacagcgtgtggggcgcctagtgggatatgcctccaggttaaa
tcctgttttgaatatactgctaaccccgctggttataatccttcaatatcaattgtgggc
acacttgaagctgaaaaagaaagaagaaaatctgggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatactcaagaactaactctgaagaggcagaaacagaaa
gtgtgcatggaggaaaccctgtggctacaggataatatcagagataaactgcgtcccatt
cccataactgcctcagtggagatccaagagccaagctctcgtaggcgagtgaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatattgatgttcac
ttcttaaaagagggatgtggagacgacaatgtatgtaacagcaaccttaaactagaatat
aaattttgcacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgacgcccatgaggctaaactg
attgcaacgtttccagacactttaacctattctgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcgcaagctgactgtgagctcgga
aatccttttaaaagaaattcaaatgtcactttttatttggttttaagtacaactgaagtc
acctttgacaccccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagttgttggcgagcaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaataaacttaggt
aaacctcttacaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatgggaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaaggtaact
tgtgagccacaaaaggagataaactccctgaacctaacggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagatgataacagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagcgtgaacgtgaactgtgtgaacatcagatgcccg
ctgcgggggctggacagcaaggcgtctcttattttgcgctcgaggttatggaacagcaca
tttctagaggaatattccaaactgaactacttggacattctcatgcgagccttcattgat
gtgactgctgctgccgaaaatatcaggctgccaaatgcaggcactcaggttcgagtgact
gtgtttccctcaaagactgtagctcagtattcgggagtaccttggtggatcatcctagtg
gctattctcgctgggatcttgatgcttgctttattagtgtttatactatggaagtgtgga
ttctttaaacgctctaggtacgatgacagtgttccccgataccatgctgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaagtatattgataaccttgaaaaaaaacagtgg
atcacaaagtggaacgaaaatgaaagctactcatag

KEGG   Homo sapiens (human): 3688
Entry
3688              CDS       T01001                                 

Gene name
ITGB1, CD29, FNRB, GPIIA, MDF2, MSK12, VLA-BETA, VLAB
Definition
(RefSeq) integrin subunit beta 1
  KO
K05719  integrin beta 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoGAP-RhoA signaling pathway
N00951  ITGA/B-RHOG-RAC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01070  ITGA/B-FAK-CDC42 signaling pathway
N01072  ITGA/B-RhoGEF-RhoA signaling pathway
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01081  Shigella IpaB/C/D to ITGA/B-TALIN/VINCULIN signaling pathway
Drug target
Valategrast hydrochloride: D10028
Volociximab: D06319
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3688 (ITGB1)
   04151 PI3K-Akt signaling pathway
    3688 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3688 (ITGB1)
   04514 Cell adhesion molecules
    3688 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3688 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3688 (ITGB1)
   04530 Tight junction
    3688 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3688 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    3688 (ITGB1)
   04670 Leukocyte transendothelial migration
    3688 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    3688 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3688 (ITGB1)
   05205 Proteoglycans in cancer
    3688 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3688 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    3688 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    3688 (ITGB1)
   05414 Dilated cardiomyopathy
    3688 (ITGB1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3688 (ITGB1)
   05131 Shigellosis
    3688 (ITGB1)
   05135 Yersinia infection
    3688 (ITGB1)
   05133 Pertussis
    3688 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    3688 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3688 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3688 (ITGB1)
   05140 Leishmaniasis
    3688 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3688 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3688 (ITGB1)
   04515 Cell adhesion molecules [BR:hsa04515]
    3688 (ITGB1)
   04090 CD molecules [BR:hsa04090]
    3688 (ITGB1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3688 (ITGB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3688 (ITGB1)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3688 (ITGB1)
CD molecules [BR:hsa04090]
 Proteins
  3688 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 3688
NCBI-ProteinID: NP_002202
OMIM: 135630
HGNC: 6153
Ensembl: ENSG00000150093
Vega: OTTHUMG00000017928
Pharos: P05556(Tclin)
UniProt: P05556
LinkDB
Structure
PDB: 

Position
10p11.22
AA seq 798 aa
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaaccaattttctggattggactgatcagttcagtttgctgtgtgtttgct
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcctact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttggag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttcggacttc
agaattggatttggctcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtcttactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggtttcgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacaa
tgtcacctggaaaataatatgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacaatttttgcagttactgaagaa
tttcagcctgtttacaaggagctgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacggcaaattgtcagaaggcgtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aatgggacatttgagtgtggcgcgtgcaggtgcaatgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggatgcttactgcaggaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtctgcggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcatgtgactgttctttggatactagtacttgtgaa
gccagcaacggacagatctgcaatggccggggcatctgcgagtgtggtgtctgtaagtgt
acagatccgaagtttcaagggcaaacgtgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcacacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccggtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacgtattcagtgaatgggaacaacgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgataattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtaacaactgtggtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system