KEGG   Homo sapiens (human): 3667Help
Entry
3667              CDS       T01001                                 

Gene name
IRS1, HIRS-1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04068  FoxO signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04722  Neurotrophin signaling pathway
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04960  Aldosterone-regulated sodium reabsorption
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    3667 (IRS1)
   04022 cGMP-PKG signaling pathway
    3667 (IRS1)
   04151 PI3K-Akt signaling pathway
    3667 (IRS1)
   04152 AMPK signaling pathway
    3667 (IRS1)
   04150 mTOR signaling pathway
    3667 (IRS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    3667 (IRS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    3667 (IRS1)
   04923 Regulation of lipolysis in adipocytes
    3667 (IRS1)
   04920 Adipocytokine signaling pathway
    3667 (IRS1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3667 (IRS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    3667 (IRS1)
  09149 Aging
   04211 Longevity regulating pathway
    3667 (IRS1)
   04213 Longevity regulating pathway - multiple species
    3667 (IRS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    3667 (IRS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    3667 (IRS1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3667 (IRS1)
   04931 Insulin resistance
    3667 (IRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 3667
NCBI-ProteinID: NP_005535
OMIM: 147545
HGNC: 6125
Ensembl: ENSG00000169047
Vega: OTTHUMG00000133179
Pharos: P35568(Tbio)
UniProt: P35568 A0A024R499
LinkDB All DBs
Structure
PDB: 

Position
2q36.3
AA seq 1242 aa AA seqDB search
MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGAAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GSARLHPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPN
GHYILSRGGNGHRCTPGTGLGTSPALAGDEAASAADLDNRFRKRTHSAGTSPTITHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPLERRGGHHR
PDSSTLHTDDGYMPMSPGVAPVPSGRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGGCSPDIGGGPSSSSSSSNAVPSGTSYGKLWTNGVGGHHSHVLPHPKPPVES
SGGKLLPCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEP
EEGARHQHLRLSTSSGRLLYAATADDSSSSTSSDSLGGGYCGARLEPSLPHPHHQVLQPH
LPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQQQPLLHPPEPKSPGEYVNIE
FGSDQSGYLSGPVAFHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQESTGV
EMGRLGPAPPGAASICRPTRAVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADMRTGIA
AEEVSLPRATMAAASSSSAASASPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPN
RNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKR
HSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ
PPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggagagcgatggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaaacgcttcttcgtactgcgcgcggccagcgaggctgggggc
ccggcgcgcctcgagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatcccccttgagagctgcttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgggacgagcactttgccatcgcggcggacagcgag
gccgagcaagacagctggtaccaggctctcctacagctgcacaaccgtgctaagggccac
cacgacggagctgcggccctcggggcgggaggtggtgggggcagctgcagcggcagctcc
ggccttggtgaggctggggaggacttgagctacggtgacgtgcccccaggacccgcattc
aaagaggtctggcaagtgatcctgaagcccaagggcctgggtcagacaaagaacctgatt
ggtatctaccgcctttgcctgaccagcaagaccatcagcttcgtgaagctgaactcggag
gcagcggccgtggtgctgcagctgatgaacatcaggcgctgtggccactcggaaaacttc
ttcttcatcgaggtgggccgttctgccgtgacggggcccggggagttctggatgcaggtg
gatgactctgtggtggcccagaacatgcacgagaccatcctggaggccatgcgggccatg
agtgatgagttccgccctcgcagcaagagccagtcctcgtccaactgctctaaccccatc
agcgtccccctgcgccggcaccatctcaacaatcccccgcccagccaggtggggctgacc
cgccgatcacgcactgagagcatcaccgccacctccccggccagcatggtgggcgggaag
ccaggctccttccgtgtccgcgcctccagtgacggcgaaggcaccatgtcccgcccagcc
tcggtggacggcagccctgtgagtcccagcaccaacagaacccacgcccaccggcatcgg
ggcagcgcccggctgcaccccccgctcaaccacagccgctccatccccatgccggcttcc
cgctgctcgccttcggccaccagcccggtcagtctgtcgtccagtagcaccagtggccat
ggctccacctcggattgtctcttcccacggcgatctagtgcttcggtgtctggttccccc
agcgatggcggtttcatctcctcggatgagtatggctccagtccctgcgatttccggagt
tccttccgcagtgtcactccggattccctgggccacaccccaccagcccgcggtgaggag
gagctaagcaactatatctgcatgggtggcaaggggccctccaccctgaccgcccccaac
ggtcactacattttgtctcggggtggcaatggccaccgctgcaccccaggaacaggcttg
ggcacgagtccagccttggctggggatgaagcagccagtgctgcagatctggataatcgg
ttccgaaagagaactcactcggcaggcacatcccctaccattacccaccagaagaccccg
tcccagtcctcagtggcttccattgaggagtacacagagatgatgcctgcctacccacca
ggaggtggcagtggaggccgactgccgggacacaggcactccgccttcgtgcccacccgc
tcctacccagaggagggtctggaaatgcaccccttggagcgtcggggggggcaccaccgc
ccagacagctccaccctccacacggatgatggctacatgcccatgtccccaggggtggcc
ccagtgcccagtggccgaaagggcagtggagactatatgcccatgagccccaagagcgta
tctgccccacagcagatcatcaatcccatcagacgccatccccagagagtggaccccaat
ggctacatgatgatgtcccccagcggtggctgctctcctgacattggaggtggccccagc
agcagcagcagcagcagcaacgccgtcccttccgggaccagctatggaaagctgtggaca
aacggggtagggggccaccactctcatgtcttgcctcaccccaaacccccagtggagagc
agcggtggtaagctcttaccttgcacaggtgactacatgaacatgtcaccagtgggggac
tccaacaccagcagcccctccgactgctactacggccctgaggacccccagcacaagcca
gtcctctcctactactcattgccaagatcctttaagcacacccagcgccccggggagccg
gaggagggtgcccggcatcagcacctccgcctttccactagctctggtcgccttctctat
gctgcaacagcagatgattcttcctcttccaccagcagcgacagcctgggtgggggatac
tgcggggctaggctggagcccagccttccacatccccaccatcaggttctgcagccccat
ctgcctcgaaaggtggacacagctgctcagaccaatagccgcctggcccggcccacgagg
ctgtccctgggggatcccaaggccagcaccttacctcgggcccgagagcagcagcagcag
cagcagcccttgctgcaccctccagagcccaagagcccgggggaatatgtcaatattgaa
tttgggagtgatcagtctggctacttgtctggcccggtggctttccacagctcaccttct
gtcaggtgtccatcccagctccagccagctcccagagaggaagagactggcactgaggag
tacatgaagatggacctggggccgggccggagggcagcctggcaggagagcactggggtc
gagatgggcagactgggccctgcacctcccggggctgctagcatttgcaggcctacccgg
gcagtgcccagcagccggggtgactacatgaccatgcagatgagttgtccccgtcagagc
tacgtggacacctcgccagctgcccctgtaagctatgctgacatgcgaacaggcattgct
gcagaggaggtgagcctgcccagggccaccatggctgctgcctcctcatcctcagcagcc
tctgcttccccgactgggcctcaaggggcagcagagctggctgcccactcgtccctgctg
gggggcccacaaggacctgggggcatgagcgccttcacccgggtgaacctcagtcctaac
cgcaaccagagtgccaaagtgatccgtgcagacccacaagggtgccggcggaggcatagc
tccgagactttctcctcaacacccagtgccacccgggtgggcaacacagtgccctttgga
gcgggggcagcagtagggggcggtggcggtagcagcagcagcagcgaggatgtgaaacgc
cacagctctgcttcctttgagaatgtgtggctgaggcctggggagcttgggggagccccc
aaggagccagccaaactgtgtggggctgctgggggtttggagaatggtcttaactacata
gacctggatttggtcaaggacttcaaacagtgccctcaggagtgcacccctgaaccgcag
cctcccccacccccaccccctcatcaacccctgggcagcggtgagagcagctccacccgc
cgctcaagtgaggatttaagcgcctatgccagcatcagtttccagaagcagccagaggac
cgtcagtag

KEGG   Homo sapiens (human): 8471Help
Entry
8471              CDS       T01001                                 

Gene name
IRS4, IRS-4, PY160
Definition
(RefSeq) insulin receptor substrate 4
  KO
K17446  insulin receptor substrate 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04068  FoxO signaling pathway
hsa04140  Autophagy - animal
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    8471 (IRS4)
   04022 cGMP-PKG signaling pathway
    8471 (IRS4)
   04152 AMPK signaling pathway
    8471 (IRS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8471 (IRS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    8471 (IRS4)
   04923 Regulation of lipolysis in adipocytes
    8471 (IRS4)
   04920 Adipocytokine signaling pathway
    8471 (IRS4)
  09149 Aging
   04211 Longevity regulating pathway
    8471 (IRS4)
   04213 Longevity regulating pathway - multiple species
    8471 (IRS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    8471 (IRS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH_11 PH_8
Motif
Other DBs
NCBI-GeneID: 8471
NCBI-ProteinID: NP_003595
OMIM: 300904
HGNC: 6128
Ensembl: ENSG00000133124
Vega: OTTHUMG00000022181
Pharos: O14654(Tbio)
UniProt: O14654
LinkDB All DBs
Position
Xq22.3
AA seq 1257 aa AA seqDB search
MASCSFTRDQATRRLRGAAAAAAAALAAVVTTPLLSSGTPTALIGTGSSCPGAMWLSTAT
GSRSDSESEEEDLPVGEEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENARKFRH
SVRAAAAAAAAAASGAAIPPLIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMV
AENESEQESWYLLLSRLILESKRRRCGTLGAQPDGEPAALAAAAAAEPPFYKDVWQVIVK
PRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRST
VIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYSISIGAHLLTLLSARRH
LGLVPLEPGGWLRRSRFEQFCHLRAIGDGEDEMLFTRRFVTPSEPVAHSRRGRLHLPRGR
RSRRAVSVPASFFRRLAPSPARPRHPAEAPNNGARLSSEVSGSGSGNFGEEGNPQGKEDQ
EGSGGDYMPMNNWGSGNGRGSGGGQGSNGQGSSSHSSGGNQCSGEGQGSRGGQGSNGQGS
GGNQCSRDGQGTAGGHGSGGGQRPGGGHGSGGGQGPGDGHGSGGGKNSGGGKGSGSGKGS
DGDGERGKSLKKRSYFGKLTQSKQQQMPPPPPPPPPPPPAGGTGGKGKSGGRFRLYFCVD
RGATKECKEAKEVKDAEIPEGAARGPHRARAFDEDEDDPYVPMRPGVATPLVSSSDYMPM
APQNVSASKKRHSRSPFEDSRGYMMMFPRVSPPPAPSPPKAPDTNKEDDSKDNDSESDYM
FMAPGAGAIPKNPRNPQGGSSSKSWSSYFSLPNPFRSSPLGQNDNSEYVPMLPGKFLGRG
LDKEVSYNWDPKDAASKPSGEGSFSKPGDGGSPSKPSDHEPPKNKAKRPNRLSFITKGYK
IKPKPQKPTHEQREADSSSDYVNMDFTKRESNTPAPSTQGLPDSWGIIAEPRQSAFSNYV
NVEFGVPFPNPANDLSDLLRAIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEVI
FNSAMTPAMALADSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPPPVARLLQEEEQ
ERRRPQSRSQSFFAAARAAVSAFPTDSLERDLSPSSAPAVASAAEPTLALSQVVAAASAL
AAAPGIGAAAAAAGFDSASARWFQPVANAADAEAVRGAQDVAGGSNPGAHNPSANLARGD
NQAGGAAAAAAAPEPPPRSRRVPRPPEREDSDNDDDTHVRMDFARRDNQFDSPKRGR
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggcgagttgctccttcactcgcgaccaagcgacaagaagactaagaggtgcagcagcg
gcggcagcggcagctctagcagcagtggtgaccaccccgcttctttcctcgggaaccccg
accgcactcattgggaccgggtcgtcttgtccgggagccatgtggctctccacggccact
ggctcccggtcagactccgagtccgaagaggaggacctgcccgtcggggaggaagtctgc
aaacgcggctacctgcggaaacagaagcatgggcacaggcgctacttcgtgctcaaactc
gagactgctgacgccccagctcggctggaatactacgaaaatgccaggaagttccggcac
agtgtccgcgccgcggcggctgcagcagcggcggccgcctctggcgccgcgatccccccg
ctcattccaccgcggcgcgtgatcaccctataccagtgcttttccgtgagccagcgagca
gatgcaaggtaccgacacctcattgctcttttcacccaagacgaatacttcgcgatggtg
gccgagaacgagtcggagcaggaaagctggtacttgctgctcagccgcctcatcctcgag
agcaagcgccgccgctgcggcacgctcggcgcgcagccggacggagagccggccgcgctg
gcggcggcagcggcggcggagccacccttctataaagatgtgtggcaggtaatagtcaaa
cccagggggctggggcacagaaaagagctgagcggcgtgttccggctgtgtctaaccgac
gaggaggtcgtgtttgtgaggctgaacaccgaagtggccagcgtggtcgtccagctcctg
agcatccgtcgctgtggacactcggagcagtatttcttcttggaagtaggcaggtccact
gtcatcggtccgggagagctctggatgcaggtcgatgactgtgtggttgcccaaaacatg
catgagctgtttttggagaagatgagagccttgtgtgcagacgaatacagagcccgctgc
cgcagctacagcatcagcatcggcgcccacctgttaaccctgctgtccgctaggaggcac
ctgggcttggtgccgctcgagccgggaggctggctcagaaggtcccgctttgagcagttt
tgccacctcagggccatcggcgacggggaagacgagatgcttttcaccaggcgcttcgta
acacccagcgagcctgtggcccactccaggcgaggaagactgcacctgcccagagggcgc
aggtcaaggagagcggtttcagtgccggccagcttttttcgccgcttagcacccagccca
gcacgtccccggcaccctgcagaagccccgaacaatggagctcgcctgtcttctgaagtg
tctggttctggctctggcaactttggggaggaaggcaatccccagggcaaagaagatcag
gaaggaagcggaggtgactacatgcctatgaacaattggggctcaggaaatggccggggc
tcaggaggtggccagggctcaaatggccaaggctccagtagccatagctcgggaggaaac
cagtgttcaggcgagggacagggatcccgaggtggtcagggctcaaatggccagggctca
ggaggaaaccagtgctctagagatggccagggcaccgcaggtgggcacggttcaggtggt
ggccagagacctggaggtgggcatggctcaggtggtggccagggacctggagatggccat
ggctcaggtggtggcaagaactctggggggggcaaaggctcaggaagtgggaaaggatcc
gatggtgatggtgaacgtggaaaatctctgaagaaaagatcctattttggcaaattaact
caaagcaagcaacagcaaatgccaccacctccaccacctcctcctccacccccaccagct
ggaggaactggtggaaaagggaagtctgggggaagattcagactttatttttgtgttgac
agaggagccacgaaagaatgcaaagaagccaaagaagtgaaagatgcagagatcccagaa
ggtgcagctcgaggtccccacagagccagagcttttgatgaagatgaggatgacccatac
gtgccaatgaggccaggggtggccacccctcttgtaagctccagtgattatatgccaatg
gctcctcaaaatgtctctgcttcaaaaaagcgccactctcgatccccttttgaagattca
agagggtacatgatgatgtttcccagagtgagcccaccacctgctccgagtcctccaaaa
gcacctgatactaataaagaggatgactcaaaggacaatgacagtgagagtgactacatg
tttatggctcctggagccggtgcaattccaaaaaaccccagaaatcctcagggtggctct
tcctccaaaagttggagctcctacttctctctaccaaacccttttcggagctcacctttg
ggacagaatgacaacagtgagtatgtgccaatgttacctggaaagttcctggggaggggc
ctagacaaagaagtctcctataactgggaccccaaagatgcagcttcaaagccttcaggt
gagggatcattctcaaagcctggagatgggggatcaccttcaaagccttcagatcatgag
cccccaaagaataaagctaagagacctaaccgactttcttttattacaaaaggatataaa
atcaagccaaaaccacaaaagcccacacatgagcagagagaagctgacagctctagtgac
tacgtcaacatggacttcactaaaagagagagcaatacaccagctccctctactcaagga
ctaccagattcgtggggcataattgctgaacccagacagtcagccttttctaattatgtg
aatgttgagtttggagtgccatttccaaatccagcaaacgacctctcagatcttttaaga
gctataccacgtgccaaccccttatctctggacagtgctaggtggccacttcctcccctt
cccctcagtgctacaggtagcaatgctattgaggaagagggtgactacattgaagtaatt
ttcaactcagcaatgacaccagccatggctcttgctgacagtgccattcgctatgatgct
gaaacaggtcgaatctatgtggtcgacccattttctgagtgctgtatggatatttctctc
tcccccagccgatgttctgaaccaccacctgtagctaggctgctgcaggaagaagagcag
gagagaagacgcccacaaagccgttctcaaagtttctttgcagcagccagagccgctgtc
tctgcttttccaacagacagcctcgagagagacctttccccatcctcagccccggctgtc
gcttcggctgcagagccgactttagccctcagccaagttgtagctgcggcctccgcgctc
gccgcagccccgggcatcggcgcagcagccgcagctgctggatttgactccgcctctgcc
cgctggtttcaacctgttgctaatgctgctgatgccgaagcagtaaggggagcccaagac
gttgccggtggctcgaaccctggagcccacaacccatctgcaaaccttgccagaggtgat
aaccaggctggcggggctgccgctgcagctgccgctccggaaccaccacctcgcagtcgc
cgggtgccaagacccccggagagagaagattctgacaacgacgacgacactcacgtgaga
atggattttgccagacgtgataatcagttcgactctcccaaaagaggtcggtaa

KEGG   Homo sapiens (human): 8660Help
Entry
8660              CDS       T01001                                 

Gene name
IRS2, IRS-2
Definition
(RefSeq) insulin receptor substrate 2
  KO
K07187  insulin receptor substrate 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04068  FoxO signaling pathway
hsa04140  Autophagy - animal
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    8660 (IRS2)
   04022 cGMP-PKG signaling pathway
    8660 (IRS2)
   04152 AMPK signaling pathway
    8660 (IRS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8660 (IRS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    8660 (IRS2)
   04923 Regulation of lipolysis in adipocytes
    8660 (IRS2)
   04920 Adipocytokine signaling pathway
    8660 (IRS2)
  09149 Aging
   04211 Longevity regulating pathway
    8660 (IRS2)
   04213 Longevity regulating pathway - multiple species
    8660 (IRS2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    8660 (IRS2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    8660 (IRS2)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    8660 (IRS2)
   04931 Insulin resistance
    8660 (IRS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 8660
NCBI-ProteinID: NP_003740
OMIM: 600797
HGNC: 6126
Ensembl: ENSG00000185950
Vega: OTTHUMG00000017338
Pharos: Q9Y4H2(Tbio)
UniProt: Q9Y4H2 Q9P084
LinkDB All DBs
Position
13q34
AA seq 1338 aa AA seqDB search
MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEA
TAGGGSAPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDE
YFAVAAENEQEQEGWYRALTDLVSEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGA
EDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTL
QLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEF
RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCR
VRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLP
AGGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQR
PSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFY
GYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTL
MRATFSGSAGRLCPSCPASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGA
ALAGSGSGSCRSDDYMPMSPASVSAPKQILQPRAAAAAAAAVPSAGPAGPAPTSAAGRTF
PASGGGYKASSPAESSPEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVSPSDAVTTGTP
PDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVLMSSPVGRILEEERLE
PQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPS
LPSMHEYPLPPEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGS
GTPGTSSDSRQRSPLSDYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPR
PSASPSSSLQPPPPPPAPGELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVA
ATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQASQPPDPHRGAKVIRADP
QGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGGGDEP
PTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVRE
EPGLPPQPQPPPPPLPQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTY
ASIDFLSHHLKEATIVKE
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcccgccgcggcacgggccgcccgggccggcgagcggagacggccccaacctc
aacaacaacaacaacaacaacaaccacagcgtgcgcaagtgcggctacctgcgcaagcag
aagcatggccacaagcgcttcttcgtgctgcgcggacccggcgcgggcggcgacgaggcg
acggcgggcggggggtcggcgccgcaaccgccgcggctcgagtactacgagagcgagaaa
aagtggcggagcaaggcaggcgcgccgaaacgggtgatcgctctcgactgctgcctgaac
atcaacaagcgcgccgacgccaagcacaagtacctgatcgccctctacaccaaggacgag
tacttcgccgtggccgccgagaacgagcaggagcaggagggctggtaccgcgcgctcacc
gacctggtcagcgagggccgcgcggccgccggagacgcgccccccgccgccgcgcccgcc
gcgtcctgcagcgcctccctgcccggcgccctgggcggctctgccggcgccgccggggcc
gaggacagctacgggctggtggctcccgccacggccgcctaccgtgaggtgtggcaggtg
aacctgaagcccaagggtctgggccagagcaagaacctgacgggggtgtaccgtctgtgc
ctgtctgcgcgcaccatcggcttcgtgaagctcaactgcgagcagccgtcggtgacgctg
cagctcatgaacatccgccgctgcggccactcggacagcttcttcttcatcgaggtgggc
cgctcggccgtcacaggccccggcgagctgtggatgcaggcggacgactcggtggtggcg
cagaacatccacgagaccatcctggaggccatgaaggcgctcaaggagctcttcgagttc
cggccgcgcagtaagagccaatcgtcggggtcgtcggccacgcaccccatcagcgtcccc
ggcgcgcgccgccaccaccacctggtcaacctgccccccagccagacgggcctggtgcgc
cgctcgcgcaccgacagcctggccgccaccccgccggcggccaagtgcagctcgtgccgg
gtgcgcaccgccagcgagggcgacggcggcgcggcggcgggagcggcggccgcgggcgcc
aggccggtgtcggtggctgggagccccctgagccccgggccggtgcgcgcgcccctgagc
cgctcgcacaccctgagcggcggctgcggcggccgcgggagcaaggtggcgctgctgccg
gcagggggcgcgctgcaacacagccgctccatgtccatgcccgtggcgcactcgccgccc
gccgccaccagccccggctccctgtcgtccagcagcggccacggctcgggctcctacccg
ccgccgcccggcccgcacccgcctctgccgcatccgctgcaccacggccccggccagcgg
ccctccagcggcagcgcctccgcctcgggctcccccagcgaccccggcttcatgtccctg
gacgagtacggctccagcccaggcgacctgcgcgccttctgcagccaccgaagcaacacg
cccgagtccatcgcggagacgcccccggcccgagacggcggcggcggcggtgagttctac
gggtacatgaccatggacaggcccctgagccactgtggccgctcctaccgccgggtctcg
ggggacgcggcccaggacctggaccgagggctgcgcaagaggacctactccctgaccacg
ccagcccggcagcggccggtgccccagccctcctctgcctcgctggatgaatacaccctg
atgcgggccaccttctcgggcagcgcgggccgcctctgcccgtcctgccccgcgtcctct
cccaaggtggcctaccacccctacccagaggactacggagacatcgagatcggctcccac
aggagctccagcagcaacctgggggcagacgacggctacatgcccatgacgcccggcgcg
gccctcgcgggcagtgggagcggcagctgcaggagcgacgactacatgcccatgagcccc
gccagcgtgtccgcccccaagcagatcttgcagcccagggccgccgccgccgccgccgcc
gccgtgccttctgcggggcctgcggggccagcacccacctctgcggcgggcaggacattc
ccggcgagcgggggcggctacaaggccagctcgcccgccgagagctcccccgaggacagt
gggtacatgcgcatgtggtgcggttccaagctgtccatggagcatgcagatggcaagctg
ctgcccaacggggactacctcaacgtgtcccccagcgacgcggtcaccacgggcaccccg
cccgacttcttctccgcagccctgcaccccggcggggagccgctcaggggcgttcccggc
tgctgctacagctccttgccccgctcctacaaggccccctacacctgtggcggggacagc
gaccagtacgtgctcatgagctcccccgtggggcgcatcctggaggaggagcgtctggag
cctcaggccacgccagggcccagccaggcggccagcgccttcggggccggccccacgcag
ccccctcaccctgtagtgccttcgcccgtgcggcctagcggcggccgcccggagggcttc
ttgggccagcgcggccgggcggtgaggcccacgcgcctgtccctggaggggctgcccagc
ctgcccagcatgcacgagtacccactgccaccggagcccaagagccccggcgagtacatc
aacatcgactttggcgagcccggggcccgcctgtcgccgcccgcgcctcccctgctggcg
tcggcggcctcgtcctcctcgctcttgtccgccagcagcccggcctcgtcgctgggctca
ggcaccccgggcaccagcagcgacagccggcagcggtctccgctctccgactacatgaac
ctcgacttcagctcccccaagtctcctaagccgggcgccccgagcggccaccccgtgggc
tccttggacggcctcctgtcccccgaggcctcctccccgtatccgccgttgcccccgcgt
ccgtccgcgtccccgtcgtcgtctctgcagccgccgccaccgccgccggccccgggggag
ctgtaccgcctgccccccgcctcggccgttgccaccgcccagggcccgggcgccgcctca
tcgttgtcctcggacaccggggacaatggtgactacaccgagatggcttttggtgtggcc
gccaccccgccgcaacctatcgcggcccccccgaagccagaagctgcccgcgtggccagc
ccgacgtcgggcgtgaagaggctgagcctcatggagcaggtgtcgggagtcgaggccttc
ctgcaggccagccagcccccggacccccaccgcggcgccaaggtcatccgcgcagacccg
caggggggccgccgccgccacagttccgagaccttctcctccaccacgacggtcaccccc
gtgtccccgtccttcgcccacaaccccaagcgccacaactcggcctccgtggaaaatgtc
tctctcaggaaaagcagcgagggcggcgtgggtgtcggccctggagggggcgacgagccg
cccacctccccacgacagttgcagccggcgccccctttggcaccgcagggccggccgtgg
accccgggtcagcccgggggcttggtcggttgtcctgggagcggtggatcgcccatgcgc
agagagacctctgccggcttccagaatggtctcaactacatcgccatcgacgtgagggag
gagcccgggctgccaccccagccgcagccgccgccgccgccgcttcctcagccgggagac
aagagctcctggggccggacccgaagcctcgggggtctcatcagcgctgtgggcgtcggc
agcaccggcggcgggtgcggggggccgggtcccggtgccctgccccctgccaacacctac
gccagcattgacttcttgtcccaccacttgaaggaggccaccatcgtgaaagagtga

DBGET integrated database retrieval system