KEGG   Homo sapiens (human): 3685Help
Entry
3685              CDS       T01001                                 

Gene name
ITGAV, CD51, MSK8, VNRA, VTNR
Definition
(RefSeq) integrin subunit alpha V
  KO
K06487  integrin alpha V
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04810  Regulation of actin cytoskeleton
hsa04919  Thyroid hormone signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06135  Cytoskeletal regulation (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
Drug target
Cilengitide: D03497
Etaracizumab: D09342
Fluciclatide F 18: D09903
Intetumumab: D09631
Maraciclatide: D09929
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3685 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3685 (ITGAV)
   04514 Cell adhesion molecules (CAMs)
    3685 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3685 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3685 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3685 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3685 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3685 (ITGAV)
   05205 Proteoglycans in cancer
    3685 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3685 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    3685 (ITGAV)
   05410 Hypertrophic cardiomyopathy (HCM)
    3685 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3685 (ITGAV)
   05414 Dilated cardiomyopathy (DCM)
    3685 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    3685 (ITGAV)
   05165 Human papillomavirus infection
    3685 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3685 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3685 (ITGAV)
   04515 Cell adhesion molecules [BR:hsa04515]
    3685 (ITGAV)
   04090 CD molecules [BR:hsa04090]
    3685 (ITGAV)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3685 (ITGAV)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3685 (ITGAV)
  Exosomal proteins of epithelial cells
   3685 (ITGAV)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3685 (ITGAV)
CD molecules [BR:hsa04090]
 Proteins
  3685 (ITGAV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 3685
NCBI-ProteinID: NP_002201
OMIM: 193210
HGNC: 6150
Ensembl: ENSG00000138448
Vega: OTTHUMG00000132635
Pharos: P06756(Tchem)
UniProt: P06756 L7RXH0
LinkDB All DBs
Structure
PDB: 

Position
2q32.1
AA seq 1048 aa AA seqDB search
MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccgccgcggcgacggctgcgcctcggtccccgcggcctcccgcttcttctc
tcgggactcctgctacctctgtgccgcgccttcaacctagacgtggacagtcctgccgag
tactctggccccgagggaagttacttcggcttcgccgtggatttcttcgtgcccagcgcg
tcttcccggatgtttcttctcgtgggagctcccaaagcaaacaccacccagcctgggatt
gtggaaggagggcaggtcctcaaatgtgactggtcttctacccgccggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggatgatccattggaatttaagtcc
catcagtggtttggagcatctgtgaggtcgaaacaggataaaattttggcctgtgcccca
ttgtaccattggagaactgagatgaaacaggagcgagagcctgttggaacatgctttctt
caagatggaacaaagactgttgagtatgctccatgtagatcacaagatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaa
atcgtatctaaatacgaccccaatgtttacagcatcaagtataataaccaattagcaact
cggactgcacaagctatttttgatgacagctatttgggttattctgtggctgtcggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccttatacaattttactggcgag
cagatggctgcatatttcggattttctgtagctgccactgacattaatggagatgattat
gcagatgtgtttattggagcacctctcttcatggatcgtggctctgatggcaaactccaa
gaggtggggcaggtctcagtgtctctacagagagcttcaggagacttccagacgacaaag
ctgaatggatttgaggtctttgcacggtttggcagtgccatagctcctttgggagatctg
gaccaggatggtttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatatcttcaatggaagatcaacaggcttgaacgcagtcccatctcaaatc
cttgaagggcagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggatatccagacttaattgtaggagcttttggtgtagat
cgagctatcttatacagggccagaccagttatcactgtaaatgctggtcttgaagtgtac
cctagcattttaaatcaagacaataaaacctgctcactgcctggaacagctctcaaagtt
tcctgttttaatgttaggttctgcttaaaggcagatggcaaaggagtacttcccaggaaa
cttaatttccaggtggaacttcttttggataaactcaagcaaaagggagcaattcgacga
gcactgtttctctacagcaggtccccaagtcactccaagaacatgactatttcaaggggg
ggactgatgcagtgtgaggaattgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccaattactatttttatggaatatcggttggattatagaacagctgctgat
acaacaggcttgcaacccattcttaaccagttcacgcctgctaacattagtcgacaggct
cacattctacttgactgtggtgaagacaatgtctgtaaacccaagctggaagtttctgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggtgcctacgaagctgagctcatcgtttccattccactgcag
gctgatttcatcggggttgtccgaaacaatgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaaatttgacttacaaatccaaagctcaaatctatttgacaaagtaagcccagttgta
tctcacaaagttgatcttgctgttttagctgcagttgagataagaggagtctcgagtcct
gatcatgtctttcttccgattccaaactgggagcacaaggagaaccctgagactgaagaa
gatgttgggccagttgttcagcacatctatgagctgagaaacaatggtccaagttcattc
agcaaggcaatgctccatcttcagtggccttacaaatataataataacactctgttgtat
atccttcattatgatattgatggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaagatctcatctttgcaaacaactgaaaagaatgacacggttgccgggcaa
ggtgagcgggaccatctcatcactaagcgggatcttgccctcagtgaaggagatattcac
actttgggttgtggagttgctcagtgcttgaagattgtctgccaagttgggagattagac
agaggaaagagtgcaatcttgtacgtaaagtcattactgtggactgagacttttatgaat
aaagaaaatcagaatcattcctattctctgaagtcgtctgcttcatttaatgtcatagag
tttccttataagaatcttccaattgaggatatcaccaactccacattggttaccactaat
gtcacctggggcattcagccagcgcccatgcctgtgcctgtgtgggtgatcattttagca
gttctagcaggattgttgctactggctgttttggtatttgtaatgtacaggatgggcttt
tttaaacgggtccggccacctcaagaagaacaagaaagggagcagcttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

KEGG   Homo sapiens (human): 3690Help
Entry
3690              CDS       T01001                                 

Gene name
ITGB3, BDPLT16, BDPLT2, CD61, GP3A, GPIIIa, GT
Definition
(RefSeq) integrin subunit beta 3
  KO
K06493  integrin beta 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa04919  Thyroid hormone signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06135  Cytoskeletal regulation (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
Disease
H00083  Allograft rejection
H00226  Glanzmann thrombasthenia
H01740  Macrothrombocytopenia
Drug target
Abciximab: D02778
Cilengitide: D03497
Elarofiban: D03971
Eptifibatide: D06888
Etaracizumab: D09342
Fluciclatide F 18: D09903
Lamifiban (DG01420): D04659 D04660
Lotrafiban hydrochloride: D04785
Maraciclatide: D09929
Orbofiban acetate: D05267
Roxifiban acetate: D05772
Sibrafiban: D05834
Tadocizumab: D06649
Tirofiban (DG00159): D01029 D08607
Xemilofiban hydrochloride: D06335
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3690 (ITGB3)
   04151 PI3K-Akt signaling pathway
    3690 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3690 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3690 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3690 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3690 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3690 (ITGB3)
   04611 Platelet activation
    3690 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3690 (ITGB3)
  09158 Development
   04380 Osteoclast differentiation
    3690 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    3690 (ITGB3)
   05205 Proteoglycans in cancer
    3690 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    3690 (ITGB3)
   05410 Hypertrophic cardiomyopathy (HCM)
    3690 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3690 (ITGB3)
   05414 Dilated cardiomyopathy (DCM)
    3690 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    3690 (ITGB3)
   05163 Human cytomegalovirus infection
    3690 (ITGB3)
   05165 Human papillomavirus infection
    3690 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3690 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3690 (ITGB3)
   04515 Cell adhesion molecules [BR:hsa04515]
    3690 (ITGB3)
   04090 CD molecules [BR:hsa04090]
    3690 (ITGB3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3690 (ITGB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3690 (ITGB3)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3690 (ITGB3)
CD molecules [BR:hsa04090]
 Proteins
  3690 (ITGB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Motif
Other DBs
NCBI-GeneID: 3690
NCBI-ProteinID: NP_000203
OMIM: 173470
HGNC: 6156
Ensembl: ENSG00000259207
Vega: OTTHUMG00000171956
Pharos: P05106(Tclin)
UniProt: P05106
LinkDB All DBs
Structure
PDB: 

Position
17q21.32
AA seq 788 aa AA seqDB search
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgcggccgcggccccggccgctctgggcgactgtgctggcgctgggggcgctg
gcgggcgttggcgtaggagggcccaacatctgtaccacgcgaggtgtgagctcctgccag
cagtgcctggctgtgagccccatgtgtgcctggtgctctgatgaggccctgcctctgggc
tcacctcgctgtgacctgaaggagaatctgctgaaggataactgtgccccagaatccatc
gagttcccagtgagtgaggcccgagtactagaggacaggcccctcagcgacaagggctct
ggagacagctcccaggtcactcaagtcagtccccagaggattgcactccggctccggcca
gatgattcgaagaatttctccatccaagtgcggcaggtggaggattaccctgtggacatc
tactacttgatggacctgtcttactccatgaaggatgatctgtggagcatccagaacctg
ggtaccaagctggccacccagatgcgaaagctcaccagtaacctgcggattggcttcggg
gcatttgtggacaagcctgtgtcaccatacatgtatatctccccaccagaggccctcgaa
aacccctgctatgatatgaagaccacctgcttgcccatgtttggctacaaacacgtgctg
acgctaactgaccaggtgacccgcttcaatgaggaagtgaagaagcagagtgtgtcacgg
aaccgagatgccccagagggtggctttgatgccatcatgcaggctacagtctgtgatgaa
aagattggctggaggaatgatgcatcccacttgctggtgtttaccactgatgccaagact
catatagcattggacggaaggctggcaggcattgtccagcctaatgacgggcagtgtcat
gttggtagtgacaatcattactctgcctccactaccatggattatccctctttggggctg
atgactgagaagctatcccagaaaaacatcaatttgatctttgcagtgactgaaaatgta
gtcaatctctatcagaactatagtgagctcatcccagggaccacagttggggttctgtcc
atggattccagcaatgtcctccagctcattgttgatgcttatgggaaaatccgttctaaa
gtagagctggaagtgcgtgacctccctgaagagttgtctctatccttcaatgccacctgc
ctcaacaatgaggtcatccctggcctcaagtcttgtatgggactcaagattggagacacg
gtgagcttcagcattgaggccaaggtgcgaggctgtccccaggagaaggagaagtccttt
accataaagcccgtgggcttcaaggacagcctgatcgtccaggtcacctttgattgtgac
tgtgcctgccaggcccaagctgaacctaatagccatcgctgcaacaatggcaatgggacc
tttgagtgtggggtatgccgttgtgggcctggctggctgggatcccagtgtgagtgctca
gaggaggactatcgcccttcccagcaggacgaatgcagcccccgggagggtcagcccgtc
tgcagccagcggggcgagtgcctctgtggtcaatgtgtctgccacagcagtgactttggc
aagatcacgggcaagtactgcgagtgtgacgacttctcctgtgtccgctacaagggggag
atgtgctcaggccatggccagtgcagctgtggggactgcctgtgtgactccgactggacc
ggctactactgcaactgtaccacgcgtactgacacctgcatgtccagcaatgggctgctg
tgcagcggccgcggcaagtgtgaatgtggcagctgtgtctgtatccagccgggctcctat
ggggacacctgtgagaagtgccccacctgcccagatgcctgcacctttaagaaagaatgt
gtggagtgtaagaagtttgaccggggagccctacatgacgaaaatacctgcaaccgttac
tgccgtgacgagattgagtcagtgaaagagcttaaggacactggcaaggatgcagtgaat
tgtacctataagaatgaggatgactgtgtcgtcagattccagtactatgaagattctagt
ggaaagtccatcctgtatgtggtagaagagccagagtgtcccaagggccctgacatcctg
gtggtcctgctctcagtgatgggggccattctgctcattggccttgccgccctgctcatc
tggaaactcctcatcaccatccacgaccgaaaagaattcgctaaatttgaggaagaacgc
gccagagcaaaatgggacacagccaacaacccactgtataaagaggccacgtctaccttc
accaatatcacgtaccggggcacttaa

DBGET integrated database retrieval system