KEGG   Homo sapiens (human): 3685Help
Entry
3685              CDS       T01001                                 

Gene name
ITGAV, CD51, MSK8, VNRA, VTNR
Definition
(RefSeq) integrin subunit alpha V
  KO
K06487  integrin alpha V
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04810  Regulation of actin cytoskeleton
hsa04919  Thyroid hormone signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06135  Cytoskeletal regulation (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
Drug target
Cilengitide: D03497
Etaracizumab: D09342
Fluciclatide F 18: D09903
Intetumumab: D09631
Maraciclatide: D09929
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3685 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3685 (ITGAV)
   04514 Cell adhesion molecules (CAMs)
    3685 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3685 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3685 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3685 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3685 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3685 (ITGAV)
   05205 Proteoglycans in cancer
    3685 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3685 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    3685 (ITGAV)
   05410 Hypertrophic cardiomyopathy (HCM)
    3685 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3685 (ITGAV)
   05414 Dilated cardiomyopathy (DCM)
    3685 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    3685 (ITGAV)
   05165 Human papillomavirus infection
    3685 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3685 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3685 (ITGAV)
   04515 Cell adhesion molecules [BR:hsa04515]
    3685 (ITGAV)
   04090 CD molecules [BR:hsa04090]
    3685 (ITGAV)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3685 (ITGAV)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3685 (ITGAV)
  Exosomal proteins of epithelial cells
   3685 (ITGAV)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3685 (ITGAV)
CD molecules [BR:hsa04090]
 Proteins
  3685 (ITGAV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 3685
NCBI-ProteinID: NP_002201
OMIM: 193210
HGNC: 6150
Ensembl: ENSG00000138448
Vega: OTTHUMG00000132635
Pharos: P06756(Tchem)
UniProt: P06756 L7RXH0
LinkDB All DBs
Structure
PDB: 

Position
2q32.1
AA seq 1048 aa AA seqDB search
MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccgccgcggcgacggctgcgcctcggtccccgcggcctcccgcttcttctc
tcgggactcctgctacctctgtgccgcgccttcaacctagacgtggacagtcctgccgag
tactctggccccgagggaagttacttcggcttcgccgtggatttcttcgtgcccagcgcg
tcttcccggatgtttcttctcgtgggagctcccaaagcaaacaccacccagcctgggatt
gtggaaggagggcaggtcctcaaatgtgactggtcttctacccgccggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggatgatccattggaatttaagtcc
catcagtggtttggagcatctgtgaggtcgaaacaggataaaattttggcctgtgcccca
ttgtaccattggagaactgagatgaaacaggagcgagagcctgttggaacatgctttctt
caagatggaacaaagactgttgagtatgctccatgtagatcacaagatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaa
atcgtatctaaatacgaccccaatgtttacagcatcaagtataataaccaattagcaact
cggactgcacaagctatttttgatgacagctatttgggttattctgtggctgtcggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccttatacaattttactggcgag
cagatggctgcatatttcggattttctgtagctgccactgacattaatggagatgattat
gcagatgtgtttattggagcacctctcttcatggatcgtggctctgatggcaaactccaa
gaggtggggcaggtctcagtgtctctacagagagcttcaggagacttccagacgacaaag
ctgaatggatttgaggtctttgcacggtttggcagtgccatagctcctttgggagatctg
gaccaggatggtttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatatcttcaatggaagatcaacaggcttgaacgcagtcccatctcaaatc
cttgaagggcagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggatatccagacttaattgtaggagcttttggtgtagat
cgagctatcttatacagggccagaccagttatcactgtaaatgctggtcttgaagtgtac
cctagcattttaaatcaagacaataaaacctgctcactgcctggaacagctctcaaagtt
tcctgttttaatgttaggttctgcttaaaggcagatggcaaaggagtacttcccaggaaa
cttaatttccaggtggaacttcttttggataaactcaagcaaaagggagcaattcgacga
gcactgtttctctacagcaggtccccaagtcactccaagaacatgactatttcaaggggg
ggactgatgcagtgtgaggaattgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccaattactatttttatggaatatcggttggattatagaacagctgctgat
acaacaggcttgcaacccattcttaaccagttcacgcctgctaacattagtcgacaggct
cacattctacttgactgtggtgaagacaatgtctgtaaacccaagctggaagtttctgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggtgcctacgaagctgagctcatcgtttccattccactgcag
gctgatttcatcggggttgtccgaaacaatgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaaatttgacttacaaatccaaagctcaaatctatttgacaaagtaagcccagttgta
tctcacaaagttgatcttgctgttttagctgcagttgagataagaggagtctcgagtcct
gatcatgtctttcttccgattccaaactgggagcacaaggagaaccctgagactgaagaa
gatgttgggccagttgttcagcacatctatgagctgagaaacaatggtccaagttcattc
agcaaggcaatgctccatcttcagtggccttacaaatataataataacactctgttgtat
atccttcattatgatattgatggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaagatctcatctttgcaaacaactgaaaagaatgacacggttgccgggcaa
ggtgagcgggaccatctcatcactaagcgggatcttgccctcagtgaaggagatattcac
actttgggttgtggagttgctcagtgcttgaagattgtctgccaagttgggagattagac
agaggaaagagtgcaatcttgtacgtaaagtcattactgtggactgagacttttatgaat
aaagaaaatcagaatcattcctattctctgaagtcgtctgcttcatttaatgtcatagag
tttccttataagaatcttccaattgaggatatcaccaactccacattggttaccactaat
gtcacctggggcattcagccagcgcccatgcctgtgcctgtgtgggtgatcattttagca
gttctagcaggattgttgctactggctgttttggtatttgtaatgtacaggatgggcttt
tttaaacgggtccggccacctcaagaagaacaagaaagggagcagcttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

KEGG   Homo sapiens (human): 3693Help
Entry
3693              CDS       T01001                                 

Gene name
ITGB5
Definition
(RefSeq) integrin subunit beta 5
  KO
K06588  integrin beta 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05205  Proteoglycans in cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Drug target
Cilengitide: D03497
Fluciclatide F 18: D09903
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3693 (ITGB5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3693 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3693 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3693 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3693 (ITGB5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    3693 (ITGB5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3693 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3693 (ITGB5)
   05414 Dilated cardiomyopathy (DCM)
    3693 (ITGB5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3693 (ITGB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3693 (ITGB5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    3693 (ITGB5)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3693 (ITGB5)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3693 (ITGB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2 DUF2975
Motif
Other DBs
NCBI-GeneID: 3693
NCBI-ProteinID: NP_002204
OMIM: 147561
HGNC: 6160
Ensembl: ENSG00000082781
Vega: OTTHUMG00000159432
Pharos: P18084(Tbio)
UniProt: P18084 L7RT22
LinkDB All DBs
Position
3q21.2
AA seq 799 aa AA seqDB search
MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
TSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSG
TYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgggccccggcgccgctgtacgcctgcctcctggggctctgcgcgctcctgccc
cggctcgcaggtctcaacatatgcactagtggaagtgccacctcatgtgaagaatgtctg
ctaatccacccaaaatgtgcctggtgctccaaagaggacttcggaagcccacggtccatc
acctctcggtgtgatctgagggcaaaccttgtcaaaaatggctgtggaggtgagatagag
agcccagccagcagcttccatgtcctgaggagcctgcccctcagcagcaagggttcgggc
tctgcaggctgggacgtcattcagatgacaccacaggagattgccgtgaacctccggccc
ggtgacaagaccaccttccagctacaggttcgccaggtggaggactatcctgtggacctg
tactacctgatggacctctccctgtccatgaaggatgacttggacaatatccggagcctg
ggcaccaaactcgcggaggagatgaggaagctcaccagcaacttccggttgggatttggg
tcttttgttgataaggacatctctcctttctcctacacggcaccgaggtaccagaccaat
ccgtgcattggttacaagttgtttccaaattgcgtcccctcctttgggttccgccatctg
ctgcctctcacagacagagtggacagcttcaatgaggaagttcggaaacagagggtgtcc
cggaaccgagatgcccctgaggggggctttgatgcagtactccaggcagccgtctgcaag
gagaagattggctggcgaaaggatgcactgcatttgctggtgttcacaacagatgatgtg
ccccacatcgcattggatggaaaattgggaggcctggtgcagccacacgatggccagtgc
cacctgaacgaggccaacgagtacactgcatccaaccagatggactatccatcccttgcc
ttgcttggagagaaattggcagagaacaacatcaacctcatctttgcagtgacaaaaaac
cattatatgctgtacaagaattttacagccctgatacctggaacaacggtggagatttta
gatggagactccaaaaatattattcaactgattattaatgcatacaatagtatccggtct
aaagtggagttgtcagtctgggatcagcctgaggatcttaatctcttctttactgctacc
tgccaagatggggtatcctatcctggtcagaggaagtgtgagggtctgaagattggggac
acggcatcttttgaagtatcattggaggcccgaagctgtcccagcagacacacggagcat
gtgtttgccctgcggccggtgggattccgggacagcctggaggtgggggtcacctacaac
tgcacgtgcggctgcagcgtggggctggaacccaacagcgccaggtgcaacgggagcggg
acctatgtctgcggcctgtgtgagtgcagccccggctacctgggcaccaggtgcgagtgc
caggatggggagaaccagagcgtgtaccagaacctgtgccgggaggcagagggcaagcca
ctgtgcagcgggcgtggggactgcagctgcaaccagtgctcctgcttcgagagcgagttt
ggcaagatctatgggcctttctgtgagtgcgacaacttctcctgtgccaggaacaaggga
gtcctctgctcaggccatggcgagtgtcactgcggggaatgcaagtgccatgcaggttac
atcggggacaactgtaactgctcgacagacatcagcacatgccggggcagagatggccag
atctgcagcgagcgtgggcactgtctctgtgggcagtgccaatgcacggagccgggggcc
tttggggagatgtgtgagaagtgccccacctgcccggatgcatgcagcaccaagagagat
tgcgtcgagtgcctgctgctccactctgggaaacctgacaaccagacctgccacagccta
tgcagggatgaggtgatcacatgggtggacaccatcgtgaaagatgaccaggaggctgtg
ctatgtttctacaaaaccgccaaggactgcgtcatgatgttcacctatgtggagctcccc
agtgggaagtccaacctgaccgtcctcagggagccagagtgtggaaacacccccaacgcc
atgaccatcctcctggctgtggtcggtagcatcctccttgttgggcttgcactcctggct
atctggaagctgcttgtcaccatccacgaccggagggagtttgcaaagtttcagagcgag
cgatccagggcccgctatgaaatggcttcaaatccattatacagaaagcctatctccacg
cacactgtggacttcaccttcaacaagttcaacaaatcctacaatggcactgtggactga

DBGET integrated database retrieval system