KEGG   Homo sapiens (human): 3696Help
Entry
3696              CDS       T01001                                 

Gene name
ITGB8
Definition
(RefSeq) integrin subunit beta 8
  KO
K06591  integrin beta 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3696 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3696 (ITGB8)
   04514 Cell adhesion molecules (CAMs)
    3696 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3696 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3696 (ITGB8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3696 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3696 (ITGB8)
   05414 Dilated cardiomyopathy (DCM)
    3696 (ITGB8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3696 (ITGB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3696 (ITGB8)
   04515 Cell adhesion molecules [BR:hsa04515]
    3696 (ITGB8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3696 (ITGB8)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3696 (ITGB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 3696
NCBI-ProteinID: NP_002205
OMIM: 604160
HGNC: 6163
Ensembl: ENSG00000105855
Vega: OTTHUMG00000023594
Pharos: P26012(Tbio)
UniProt: P26012 Q9BUG9
LinkDB All DBs
Structure
PDB: 

Position
7p21.1
AA seq 769 aa AA seqDB search
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLA
LGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCR
NVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTS
CALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
DYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggctcggccctggctttttttaccgctgcatttgtctgcctgcaaaacgaccgg
cgaggtcccgcctcgttcctctgggcagcctgggtgttttcacttgttcttggactgggc
caaggtgaagacaatagatgtgcatcttcaaatgcagcatcctgtgccaggtgccttgcg
ctgggtccagaatgtggatggtgtgttcaagaggatttcatttcaggtggatcaagaagt
gaacgttgtgatattgtttccaatttaataagcaaaggctgctcagttgattcaatagaa
tacccatctgtgcatgttataatacccactgaaaatgaaattaatacccaggtgacacca
ggagaagtgtctatccagctgcgtccaggagccgaagctaattttatgctgaaagttcat
cctctgaagaaatatcctgtggatctttattatcttgttgatgtctcagcatcaatgcac
aataatatagaaaaattaaattccgttggaaacgatttatctagaaaaatggcatttttc
tcccgtgactttcgtcttggatttggctcatacgttgataaaacagtttcaccatacatt
agcatccaccccgaaaggattcataatcaatgcagtgactacaatttagactgcatgcct
ccccatggatacatccatgtgctgtctttgacagagaacatcactgagtttgagaaagca
gttcatagacagaagatctctggaaacatagatacaccagaaggaggttttgacgccatg
cttcaggcagctgtctgtgaaagtcatatcggatggcgaaaagaggctaaaagattgctg
ctggtgatgacagatcagacgtctcatctcgctcttgatagcaaattggcaggcatagtg
gtgcccaatgacggaaactgtcatctgaaaaacaacgtctatgtcaaatcgacaaccatg
gaacacccctcactaggccaactttcagagaaattaatagacaacaacattaatgtcatc
tttgcagttcaaggaaaacaatttcattggtataaggatcttctacccctcttgccaggc
accattgctggtgaaatagaatcaaaggctgcaaacctcaataatttggtagtggaagcc
tatcagaagctcatttcagaagtgaaagttcaggtggaaaaccaggtacaaggcatctat
tttaacattaccgccatctgtccagatgggtccagaaagccaggcatggaaggatgcaga
aacgtgacgagcaatgatgaagttcttttcaatgtaacagttacaatgaaaaaatgtgat
gtcacaggaggaaaaaactatgcaataatcaaacctattggttttaatgaaaccgctaaa
attcatatacacagaaactgcagctgtcagtgtgaggacaacagaggacctaaaggaaag
tgtgtagatgaaacttttctagattccaagtgtttccagtgtgatgagaataaatgtcat
tttgatgaagatcagttttcttctgagagttgcaagtcacacaaggatcagcctgtttgc
agtggtcgaggagtttgtgtttgtgggaaatgttcatgtcacaaaattaagcttggaaaa
gtgtatggaaaatactgtgaaaaggatgacttttcttgtccatatcaccatggaaatctg
tgtgctgggcatggagagtgtgaagcaggcagatgccaatgcttcagtggctgggaaggt
gatcgatgccagtgcccttcagcagcagcccagcactgtgtcaattcaaagggccaagtg
tgcagtggaagaggcacgtgtgtgtgtggaaggtgtgagtgcaccgatcccaggagcatc
ggccgcttctgtgaacactgccccacctgttatacagcctgcaaggaaaactggaattgt
atgcaatgccttcaccctcacaatttgtctcaggctatacttgatcagtgcaaaacctca
tgtgctctcatggaacaacagcattatgtcgaccaaacttcagaatgtttctccagccca
agctacttgagaatatttttcatcattttcatagttacattcttgattgggttgcttaaa
gtcctgatcattagacaggtgatactacaatggaatagtaataaaattaagtcctcatca
gattacagagtgtcagcctcaaaaaaggataagttgattctgcaaagtgtttgcacaaga
gcagtcacctaccgacgtgagaagcctgaagaaataaaaatggatatcagcaaattaaat
gctcatgaaactttcaggtgcaacttctaa

DBGET integrated database retrieval system