KEGG   Homo sapiens (human): 3708Help
Entry
3708              CDS       T01001                                 

Gene name
ITPR1, ACV, CLA4, INSP3R1, IP3R, IP3R1, PPP1R94, SCA15, SCA16, SCA29
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05016  Huntington disease
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    3708 (ITPR1)
   04020 Calcium signaling pathway
    3708 (ITPR1)
   04070 Phosphatidylinositol signaling system
    3708 (ITPR1)
   04022 cGMP-PKG signaling pathway
    3708 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    3708 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    3708 (ITPR1)
   04210 Apoptosis
    3708 (ITPR1)
   04218 Cellular senescence
    3708 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    3708 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    3708 (ITPR1)
   04621 NOD-like receptor signaling pathway
    3708 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    3708 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    3708 (ITPR1)
   04912 GnRH signaling pathway
    3708 (ITPR1)
   04915 Estrogen signaling pathway
    3708 (ITPR1)
   04921 Oxytocin signaling pathway
    3708 (ITPR1)
   04918 Thyroid hormone synthesis
    3708 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    3708 (ITPR1)
   04924 Renin secretion
    3708 (ITPR1)
   04925 Aldosterone synthesis and secretion
    3708 (ITPR1)
   04927 Cortisol synthesis and secretion
    3708 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    3708 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    3708 (ITPR1)
   04971 Gastric acid secretion
    3708 (ITPR1)
   04972 Pancreatic secretion
    3708 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    3708 (ITPR1)
   04725 Cholinergic synapse
    3708 (ITPR1)
   04728 Dopaminergic synapse
    3708 (ITPR1)
   04726 Serotonergic synapse
    3708 (ITPR1)
   04720 Long-term potentiation
    3708 (ITPR1)
   04730 Long-term depression
    3708 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    3708 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3708 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    3708 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    3708 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    3708 (ITPR1)
   05016 Huntington disease
    3708 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    3708 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3708 (ITPR1)
   05163 Human cytomegalovirus infection
    3708 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3708 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3708 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3708 (ITPR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     3708 (ITPR1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  IP3 receptor
   3708 (ITPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 3708
NCBI-ProteinID: NP_001161744
OMIM: 147265
HGNC: 6180
Ensembl: ENSG00000150995
Vega: OTTHUMG00000154996
Pharos: Q14643(Tchem)
UniProt: Q14643
LinkDB All DBs
Position
3p26.1
AA seq 2743 aa AA seqDB search
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTL
RGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTSPVKEDKEAFAIVPV
SPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVL
EVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRL
CYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEI
DTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRF
EFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAKEGQKEDRDVLSYYR
YQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDP
QEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEFVEEYLRDVVCQRFPF
SDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVTTIFPISKMAKGEE
NKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEPEKEDI
MVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEGPSNVP
GALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFR
HFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDETMDG
ASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQQQRLL
RNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNP
GILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKK
CQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVELLAVCT
EGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSNH
MWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTRQ
PVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKS
HSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQAELSVL
VDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLREMMTKD
RGYGEKLISIDELDNAELPPAPDSENATEELEPSPPLRQLEDHKRGEALRQVLVNRYYGN
VRPSGRRESLTSFGNGPLSAGGPGKPGGGGGGSGSSSMSRGEMSLAEVQCHLDKEGASNL
VIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKVA
QQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAF
TTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNF
LRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGP
CHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIMESRHDSE
NAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAHQLARHN
KELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRI
YYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLM
NLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTILRLIFS
VGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLVICAMGLF
VHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDF
ILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHT
CETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFG
VIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVL
VKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMK
LVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8232 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagcttcctacatattggagacatttgttctctgtacgcggag
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaaaccggggaccttaacaatccacctaagaaattcagagactgcctctttaagcta
tgtcccatgaaccgctactctgcccaaaagcagttctggaaagccgctaagcctggggcc
aacagcaccacagacgcagtgctactcaacaaactgcaccacgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaacagtgaataagaggcttcctgct
ctgttggagaagaatgccatgagagtcacattggacgaggctggaaatgaagggtcctgg
ttttatattcagccattctacaagctgcgatccattggagacagcgtggtcataggtgac
aaggtggttctgaaccccgtcaatgctggtcagcccctacatgctagcagccatcaactg
gtagataacccaggctgcaatgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagacgacatattaaaggggggtgacgtggtg
aggctgtttcatgctgagcaggagaagtttctcacctgtgacgaacacaggaagaagcag
cacgtcttcctgagaaccacgggccggcagtcggccacatctgccaccagttcaaaagcc
ctgtgggaggtggaggtggtccagcatgacccatgtcggggcggagcagggtattggaac
agccttttccgtttcaagcatctggccacggggcattacttggcagcagaggtggaccct
gatcaggacgcctctcgaagtaggttgcggaatgcccaagaaaagatggtatactccctg
gtctctgtgcctgaaggcaatgacatctcctccattttcgagctagatcccaccactctg
cgtggaggtgacagccttgtcccaaggaactcttatgttcggctcagacacctatgtact
aatacctgggttcacagcacaaatattcctattgacaaggaagaagaaaagcccgtgatg
ctgaaaattggcacctctcctgtgaaggaggataaggaagcatttgccatagttccggtt
tctcctgctgaagttcgggacctggactttgccaatgatgccagcaaggtgctgggctcc
attgctgggaagctagagaagggcaccatcacccagaatgaaaggaggtctgtaaccaag
ctgctagaagatttggtttacttcgtcactggtggaactaattctggtcaagatgttctc
gaagttgtcttctccaagcccaacagagaacggcagaaactgatgagagaacagaatatt
ctcaagcagatcttcaagttgttacaagccccattcacagactgcggtgatggcccaatg
cttcggctggaagagctcggggaccagcggcacgctcctttcagacacatctgccggctc
tgctacagggtgctgagacactcgcagcaagactacaggaagaaccaggagtatatagcc
aagcagtttggcttcatgcagaagcagattggctatgatgtgttggctgaagacactatc
actgccctgctccacaataatcggaaactcctggaaaaacacattaccgcggcagagatt
gacacatttgtcagcctggtgcgaaagaacagggagcccagattcttagattacctctcc
gacctctgtgtctccatgaacaaatcaattccagtgacccaggaactgatatgtaaagct
gtgctgaaccccaccaacgctgacatcctgattgagaccaagttggttctttctcgtttt
gaatttgaaggtgtctcttccactggagagaatgctctggaggcaggagaagacgaggaa
gaggtgtggctgttttggagggacagcaacaaagagattcgcagcaagagtgtgagggaa
ttggctcaggatgctaaagaagggcagaaggaggaccgagacgttctcagctactacaga
tatcagctgaacctctttgcgaggatgtgtctggaccgccaatacctggccatcaacgaa
atctcaggccagctggatgtcgatctcattctccgctgcatgtctgacgagaacctgccc
tatgacctcagggcgtccttctgccgcctcatgcttcacatgcatgtggaccgagatccc
caggaacaagtcacccccgtgaaatatgcccgcctctggtcggagattccctcggagatc
gccattgacgactatgatagtagtggagcttccaaagatgaaattaaggagagatttgct
cagaccatggagtttgtggaggagtatttaagagatgtggtttgtcagaggttccctttc
tctgataaagagaagaataagcttacgtttgaggttgtaaatttagctaggaatctcata
tactttggtttctacaacttctctgaccttctacgattaactaagatccttctggccata
ttggactgtgtacatgtgacaacaatcttccccattagcaagatggcgaaaggagaagag
aataaaggtaacaatgatgtggagaagctgaagagcagtaacgtgatgagatctattcat
ggcgtgggagagctgatgacccaggtggtgctccggggaggaggctttttgcccatgact
cccatggctgctgcccctgaaggcaatgtgaagcaggcagagcctgagaaggaggacatc
atggtcatggacaccaagctgaagatcattgagatactccagtttattttgaatgtgagg
ttggattataggatctcctgcctcctgtgtatatttaagcgagagtttgatgaaagcaat
tcccagacttcagaaacatcctccggaaacagcagccaagaagggccaagtaatgtacca
ggtgctcttgactttgaacacattgaagaacaagcagaaggcatctttggaggaagtgag
gagaacaccccactggacttggatgaccacggcggcagaacctttctccgtgtcctgctc
cacttgacgatgcatgactacccacccctggtgtcaggggccctgcagctcctcttccgg
cacttcagccagaggcaggaggtgctccaggccttcaaacaggttcaactgctggttacc
agccaagatgtggacaactacaaacagatcaaacaagacttggatcaactgaggtccatc
gtggaaaagtcagagctttgggtgtacaaagggcagggccccgatgagactatggatggt
gcatctggagaaaatgaacataagaaaacggaggagggaaataacaagccacaaaagcat
gaaagcaccagcagctacaactacagagtggtcaaagagattttgattcggcttagcaaa
ctctgtgttcaagagagtgcctcagtgagaaagagcaggaagcagcaacagcgtctgctc
cggaacatgggcgcgcacgccgtggtgctggagctgctgcagattccctatgagaaggcc
gaagataccaagatgcaagagataatgaggttggctcatgaatttttgcagaatttctgc
gcaggcaaccagcagaatcaagctttgctacataaacacataaacctgtttctcaaccca
gggatcctggaggcagtaaccatgcagcacatcttcatgaacaatttccagctttgcagt
gagatcaacgagagagttgttcagcacttcgttcactgcatagagactcacggtcggaat
gtccagtatataaagttcttacagacaattgtcaaggcagaagggaaatttattaaaaaa
tgccaagacatggttatggccgagctggtcaattcgggagaggatgtcctcgtgttctac
aacgacagagcctctttccagactctgatccagatgatgcggtcagaacgggatcggatg
gatgagaacagccctctcatgtaccacatccacttggtcgagctcctggctgtgtgcacg
gagggtaagaatgtctacacagagatcaagtgcaactccctgctcccgctggatgacatc
gttcgcgtggtgacccacgaggactgcatccctgaggttaaaattgcatacattaacttc
ctgaatcactgctatgtggatacagaggtggaaatgaaggagatttataccagcaatcac
atgtggaaattgtttgagaatttccttgtagacatctgcagggcctgtaacaacactagt
gacaggaaacatgcagactcgattttggagaagtatgtcaccgaaatcgtcatgagtatt
gttactactttcttcagctctcccttctcagaccagagtacgactttgcagactcgccag
cctgtctttgtgcaactgctgcaaggcgtgttcagggtttaccactgcaactggttaatg
ccaagccaaaaagcctccgtggagagctgtattcgggtgctgtctgatgtagccaagagc
cgggccattgccattcccgtggacctggacagccaagtcaacaacctctttctcaagtcc
cacagcattgtgcagaaaacagccatgaactggcggctctcagcccgcaatgccgcacgc
agggactctgttctggcagcttccagagactaccggaatatcattgagagattgcaggac
atcgtctccgcgctggaggaccgtctcaggcccctggtgcaggcagagttatctgtgctc
gtggatgttctccacagacccgagctgcttttcccagagaacacagacgccagaaggaaa
tgtgaaagtggcggtttcatttgcaagttaataaagcatacaaaacagctgctagaagaa
aatgaagagaagctctgcattaaggtcctacagaccctgagggaaatgatgaccaaagat
agaggctatggagaaaagctaatttccattgatgaattggataatgctgagcttcctcca
gctccggattctgagaacgccactgaggagcttgaaccaagtccacccctgcggcagctg
gaagaccataaaaggggtgaggcgctcaggcaagttctggtcaaccgttactatggaaac
gtcagaccttcgggacgaagagagagccttaccagctttggcaatggcccactgtcagca
ggaggacccggcaagcccgggggaggagggggaggttccggatccagctctatgagcagg
ggtgagatgagtctggccgaggttcagtgtcaccttgacaaggagggggcttccaatcta
gttatcgacctcatcatgaacgcatccagtgaccgagtgttccatgaaagcattctcctg
gccattgcccttctggaaggaggcaacaccaccatccagcactcctttttctgtcgcttg
acagaagataagaagtcagagaaattctttaaggtgttttatgaccggatgaaggtggcc
cagcaagaaatcaaagcaacagtgacagtgaacaccagtgacttgggaaataaaaagaaa
gacgatgaggtagacagggatgccccatcacggaaaaaagctaaagagcccacaacacag
ataacagaagaggtccgggatcagctcctggaggcctccgctgccaccaggaaagccttc
accactttcaggagggaggctgatcccgacgaccactaccagcctggagagggcacccag
gccactgccgacaaggccaaggacgacctggagatgagcgcggtcatcaccatcatgcag
cccatcctccgcttccttcagctcctgtgtgaaaaccacaaccgagacctgcagaacttc
ctccgttgccaaaataacaagaccaactacaatttggtatgtgagaccctgcagtttctg
gactgtatttgtggaagcacaactggaggccttggtcttctgggcttgtatataaatgaa
aagaacgtagcgcttatcaaccaaaccctggaaagtctgaccgaatactgtcaaggacct
tgccatgagaaccagaactgcatagccacccatgaatccaatggcattgacatcatcaca
gccctgatcctcaatgatatcaatcctttgggaaagaagaggatggaccttgtgttagaa
ctgaagaacaatgcctcgaagttgctcctggccatcatggaaagcaggcacgacagtgaa
aacgcagagaggatactttataacatgaggcccaaggaactggtggaagtgatcaagaaa
gcctacatgcaaggtgaagtggaatttgaggatggagaaaacggtgaggatggggcggcg
tcccccaggaacgtggggcacaacatctacatattagcccatcagttggctcggcataac
aaagaacttcagagcatgctgaaacctggtggccaagtggacggagatgaagccctggag
ttttatgccaagcacacggcgcagatagagattgtcagattagaccgaacaatggaacag
atagtctttcccgtgcccagcatatgtgaattcctaaccaaggagtcaaaactacgaatt
tactatactacagagagagacgaacaaggcagcaaaatcaatgatttctttctgcggtct
gaagacctcttcaatgaaatgaattggcagaagaaactgagagcccagcccgtgttgtac
tggtgtgcccgcaacatgtctttctggagcagcatttcgtttaacctggccgtcctgatg
aacctgctggtggcgtttttctacccgtttaagggagtccgaggaggaaccctggagccc
cactggtcgggactcctgtggacagccatgctcatctctctggccatcgtcattgccctc
cccaagccccatggcatccgggccttaattgcctccacaattctacgactgatattttca
gtcgggttacaacccacgttgtttcttctgggcgctttcaatgtatgcaataaaatcatc
tttctaatgagctttgtgggcaactgtgggacattcacaagaggctaccgagccatggtt
ctggatgttgagttcctctatcatttgttgtatctggtgatctgtgccatggggctcttt
gtccatgaattcttctacagtctgctgctttttgatttagtgtacagagaagagactttg
cttaatgtcattaaaagtgtcactcgcaatggacggtccatcatcctgacagcagttctg
gctctgatcctcgtttacctgttctcaatagtgggctatcttttcttcaaggatgacttt
atcttggaagtagataggctgcccaatgaaacagctgttccagaaaccggcgagagtttg
gcaagcgagttcctgttctccgatgtgtgtagggtggagagtggggagaactgctcctct
cctgcacccagagaagagctggtccctgcagaagagacggaacaggataaagagcacaca
tgtgagacgctgctgatgtgcattgtcactgtgctgagtcacgggctgcggagcgggggt
ggagtaggagatgtactcaggaagccgtccaaagaggaacccctgtttgctgctagagtt
atttatgacctcttgttcttcttcatggtcatcatcattgttcttaacctgatttttggg
gttatcattgacacttttgctgacctgaggagtgagaagcagaagaaggaagagatcttg
aagaccacgtgctttatctgtggcttggaaagagacaagtttgacaacaagactgtcacc
tttgaagagcacatcaaggaagaacacaacatgtggcactatctgtgcttcatcgtcctg
gtgaaagtaaaggactccaccgaatatactgggcctgagagttacgtggcagaaatgatc
aaggaaagaaaccttgactggttccccaggatgagagccatgtcattggtcagcagtgat
tctgaaggagaacagaatgagctgagaaacctgcaggagaagctggagtccaccatgaaa
cttgtcacgaacctttctggccagctgtcggaattaaaggatcagatgacagaacaaagg
aagcagaaacaaagaattggtcttctaggacatcctcctcacatgaatgtcaacccacaa
caaccagcataa

KEGG   Homo sapiens (human): 3709Help
Entry
3709              CDS       T01001                                 

Gene name
ITPR2, ANHD, CFAP48, INSP3R2, IP3R2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04114  Oocyte meiosis
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
Disease
H02281  Isolated anhidrosis with normal sweat glands
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    3709 (ITPR2)
   04020 Calcium signaling pathway
    3709 (ITPR2)
   04070 Phosphatidylinositol signaling system
    3709 (ITPR2)
   04022 cGMP-PKG signaling pathway
    3709 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    3709 (ITPR2)
   04210 Apoptosis
    3709 (ITPR2)
   04218 Cellular senescence
    3709 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    3709 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    3709 (ITPR2)
   04621 NOD-like receptor signaling pathway
    3709 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    3709 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    3709 (ITPR2)
   04912 GnRH signaling pathway
    3709 (ITPR2)
   04915 Estrogen signaling pathway
    3709 (ITPR2)
   04921 Oxytocin signaling pathway
    3709 (ITPR2)
   04918 Thyroid hormone synthesis
    3709 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    3709 (ITPR2)
   04924 Renin secretion
    3709 (ITPR2)
   04925 Aldosterone synthesis and secretion
    3709 (ITPR2)
   04927 Cortisol synthesis and secretion
    3709 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    3709 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    3709 (ITPR2)
   04971 Gastric acid secretion
    3709 (ITPR2)
   04972 Pancreatic secretion
    3709 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    3709 (ITPR2)
   04725 Cholinergic synapse
    3709 (ITPR2)
   04728 Dopaminergic synapse
    3709 (ITPR2)
   04726 Serotonergic synapse
    3709 (ITPR2)
   04720 Long-term potentiation
    3709 (ITPR2)
   04730 Long-term depression
    3709 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    3709 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3709 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    3709 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    3709 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    3709 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3709 (ITPR2)
   05163 Human cytomegalovirus infection
    3709 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3709 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3709 (ITPR2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  IP3 receptor
   3709 (ITPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207 Sec2p
Motif
Other DBs
NCBI-GeneID: 3709
NCBI-ProteinID: NP_002214
OMIM: 600144
HGNC: 6181
Ensembl: ENSG00000123104
Vega: OTTHUMG00000169181
Pharos: Q14571(Tbio)
UniProt: Q14571
LinkDB All DBs
Position
12p11.23
AA seq 2701 aa AA seqDB search
MTEKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGVPPTSKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSASGSPDTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGE
IGESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVN
TLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEHQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFVEEGNTLRKILLNRYFKGDYSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLK
EGMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVALVNQNLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFF
FSKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPT
IPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
NT seq 8106 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcagcaccttggggttagtggatgacagatgtgtggtgcac
ccagaggccggggaccttgccaaccctcccaagaagttcagagactgccttttcaaggtg
tgccctatgaacagatattctgcccagaagcaatattggaaagcaaagcaagccaaacaa
gggaaccacaccgaggcagccttgctgaagaaactacagcacgctgcagaactggaacaa
aaacaaaatgaatcggagaataagaaactgttgggagaaattgtaaaatacagtaatgtt
atacaactactgcatataaaaagcaacaaatatcttactgtcaacaagagattacctgct
ttactggagaagaatgccatgcgtgtgtccttggatgctgcaggaaatgaagggtcttgg
ttttatattcatccgttctggaaactgagaagcgagggtgacaatattgttgtaggagat
aaagttgttttgatgcctgtgaatgcagggcagccactacatgccagcaacatagagctt
cttgataacccagggtgtaaagaggtgaatgctgtcaattgcaacaccagctggaaaatc
actttattcatgaaatatagttcctatcgagaggatgtattaaaaggaggggacgttgtt
agattatttcatgcggaacaagagaagtttttgacttgtgatgaatatgagaaaaaacag
cacattttccttcgtacgaccttgcgccaatcagctacttctgctactagttctaaagca
ctctgggaaatagaggtggttcatcatgacccatgccgtgggggtgcaggacagtggaac
agcttgttcagatttaagcatcttgcaactggaaactatttagctgcagagcttaatcct
gattatcgagatgcccaaaatgaaggaaaaaatgtgagagatggagtccctccaacttca
aagaaaaaacgccaggcaggggagaagatcatgtatactttggtttcagtcccgcatggc
aatgacattgcatccctttttgaactagatgccacaactcttcagagagctgactgcctg
gttccaaggaactcatatgttcggttaaggcatttatgcaccaacacatgggtaaccagt
actagtatccccatagacacagatgaagagaggcctgttatgttaaagattggaacctgc
caaaccaaagaagataaagaagcgttcgcaatcgtgtctgttccactgtctgaagttcga
gacttagactttgccaatgatgccaataaagtactagcgaccacagttaaaaagctagaa
aacggcacaataactcagaatgaaaggaggtttgtaaccaaattattggaagatctcata
ttctttgttgctgatgtgcctaataatggacaagaagttctggatgtggttatcactaag
ccaaaccgagagcgtcaaaaattgatgagggaacaaaacatactggcacaggtatttgga
attcttaaagcaccctttaaagagaaagcaggagaaggctcgatgctgagacttgaagat
ctgggggatcaaagatatgcaccctacaagtacatgctgcggctctgttaccgcgtcctg
agacactcgcagcaggattaccggaaaaatcaggaatatattgctaagaatttctgtgtc
atgcagtcccagattggctatgatattttggcagaagatactatcacagctttgttgcac
aacaacagaaaactactagagaaacatatcacagcaaaagaaatagaaacatttgtcagt
ttactcaggagaaatcgggagccaaggtttttggattatttgtcagatctgtgtgtgtct
aataccactgctatccctgtaactcaagaactcatctgtaaatttatgttgagtccaggc
aatgcagacattctcattcaaactaaggtggtctcaatgcaagcagacaaccccatggag
agctccatcctttcagatgacattgatgatgaagaagtttggctctattggattgacagc
aacaaggaacctcatggcaaagctatcaggcaccttgctcaagaggcaaaagaaggcacc
aaagctgacttagaagttcttacctattacaggtaccagctaaacctctttgcaaggatg
tgcttggatcgccagtatctggccataaaccagatttctacacagctgtctgtagacctg
atcctgcggtgtgtgtcggatgagagcctgccgttcgacctccgagcgtccttctgtcgc
ctcatgctccacatgcacgttgaccgggatccccaggagtccgtggtgcctgttcgctat
gccaggctctggacagaaatccccacaaagatcacaattcatgaatatgattctataaca
gactcttccagaaatgatatgaagaggaaatttgccctgacaatggaatttgttgaagaa
tatttgaaagaagttgtaaaccagccctttccttttggggataaagaaaaaaataaactg
acatttgaggtggtccacttggctcggaatcttatatactttggattttatagtttcagt
gagttattaaggctaacaagaacacttctggctattttagacattgtacaggcccccatg
tcatcatactttgaaagattaagcaaatttcaagatggaggaaacaatgtgatgagaacc
attcatggggtgggagagatgatgacccagatggtactcagtagaggctccatcttcccc
atgagcgtgccggatgtgccacccagcatccacccgagcaagcaagggagccccaccgag
cacgaggatgtgactgtgatggacaccaagctgaagatcattgagattttgcagtttatc
ctgagtgtcagactggattataggatctcatatatgctgtcaatatataagaaggagttt
ggagaggacaatgacaatgcggagacatctgccagtggatctccagacactttactacca
tcagctattgttcctgatatagatgaaattgcagctcaggcagaaactatgtttgcggga
agaaaagaaaaaaatccagttcaacttgacgatgaaggaggcaggacgtttttacgggtc
ctcattcatctgatcatgcacgactacccgcctttgctgtctggagccctgcagctgttg
tttaagcacttcagccagagggcagaggttttacaggcatttaagcaggtgcaattactg
gtgtctaatcaagacgtagataactacaagcaaatcaaggcagatctagaccagcttcga
ctgacagtagaaaagtctgagctatgggtggagaagagcagcaactatgagaatggagaa
ataggggaaagtcaagtgaaaggtggtgaagagccaattgaggaatcaaacattttaagt
ccagtgcaggatggaacaaagaaacctcagattgacagcaacaagagcaataactaccgg
attgtaaaggagattttgatcaggctaagtaaactctgtgtgcagaataaaaagtgtcgg
aatcaacatcaacgattactgaaaaatatgggggcgcattcggtggtgttggatcttctg
cagataccctatgaaaagaatgatgaaaagatgaatgaagtaatgaatctagcccataca
tttctgcagaatttctgtcgaggaaatccacagaatcaagttcttcttcataaacatctg
aatttgtttttaactccaggtctccttgaagcagaaaccatgcggcacatcttcatgaac
aattaccatctgtgcaacgaaattagcgagagagttgtacaacactttgtgcactgcatt
gagacacatggccgccacgtggagtacctgaggtttttgcaaacaattgtaaaagcagat
ggtaaatatgtgaagaaatgccaggatatggtaatgacagagttgataaatgggggtgaa
gacgtgctgatattttacaatgatagagcatcatttccaatccttctccatatgatgtgt
tcagagagagaccgaggggatgagagtggccccttagcctaccacatcaccctggtggag
ttgctggcagcatgcacagaggggaaaaatgtctacactgaaatcaagtgtaattccctt
ctcccgctggacgacatagtgagggtggtgacccatgacgactgcatccctgaggttaaa
attgcttatgtgaactttgttaatcactgttatgttgacactgaagtggaaatgaaagaa
atctatacaagtaaccacatttggaaattatttgagaacttcttggtggatatggcaagg
gtttgcaacacaactacagacaggaaacatgcagacatctttttggaaaagtgtgttact
gagtcaataatgaatattgtgagcggcttctttaattctcccttttcagacaatagtacc
agcctccagacacatcagccagtttttattcagctactgcaatctgccttcagaatttac
aattgcacctggccaaacccagcgcagaaagcctcagtggaatcctgtatcagaactttg
gctgaagtggcaaaaaatcgtggaattgccattccagtggatttggacagccaagttaat
actcttttcatgaagagccattcaaatatggtgcagagagcagcaatgggttggagacta
tcagctcgctctgggccacgctttaaggaagctcttggagggcctgcttgggattacaga
aatattattgaaaagttacaggatgtagtggcctccttggagcaccagttcagcccaatg
atgcaggctgaattctcagtgttggttgatgtattgtacagtccagaactgctgttccct
gagggaagcgatgcaagaataagatgtggcgctttcatgtcgaagttgattaatcataca
aagaaactaatggagaaagaagaaaaactgtgcattaaaattcttcagacattacgagaa
atgttagagaagaaagacagctttgtggaagagggtaacacattaagaaagatacttctg
aatcgatactttaaaggtgattatagtattggtgtgaatggacacctatcaggagcctac
tccaaaactgcacaggtgggaggaagcttttctggacaagattcagataagatggggata
tcaatgtcagacattcagtgtctgctggataaagaaggtgcatcagaacttgtcatcgat
gttatagtgaacaccaaaaatgacagaattttttcagaaggcattttcctcggcattgcc
ttgcttgaaggaggaaatacacaaacacagtattctttctaccagcagttgcatgaacaa
aaaaagtcagaaaaattctttaaagttctctatgatcgaatgaaggctgctcagaaagaa
ataagatcaacagtgacagttaataccatagatttaggtaacaaaaaaagggacgatgac
aatgaattgatgacatctggtccacgaatgagagtaagagattcaacactacatttaaaa
gagggaatgaaagggcaattaacagaagcttcttcagcaacatccaaagcatattgtgta
tacagaagagaaatggatccagaaatagacattatgtgcacaggaccagaagcgggaaac
actgaggaaaaatccgcagaggaagtaacaatgagtcccgcaattgccatcatgcagcca
atactgagatttcttcagttactgtgtgagaatcacaaccgggaattgcagaacttcttg
aggaatcaaaacaacaaaacaaattacaacctagtctgtgagacccttcagtttctggac
tgcatttgtggaagtacaaccggtggcctgggcctgttgggtctctacatcaatgagaag
aatgtagcgctggtcaaccagaacctggagagcttgactgagtattgccagggcccttgc
catgaaaatcagacctgtatcgctacacatgagtctaatgggattgatatcatcattgct
ttgattctgaatgacataaaccctcttggtaaataccgaatggacctggtgctccagcta
aagaacaatgcatctaaacttttgctggccattatggaaagcagacatgacagtgagaat
gcagaaagaattctttttaacatgagacccagagaactggtggatgtgatgaagaatgcc
tataaccaaggattggaatgtgaccatggggatgatgagggtggagatgatggtgtttct
ccaaaagatgttggacacaatatctatattctggcccatcagttggcccgccacaataaa
ctgttgcagcagatgctcaaaccaggatcggatccagatgaaggagatgaagccttaaag
tattatgccaaccacactgcacagattgagattgtccggcatgataggaccatggaacaa
atagtttttcctgtccccaatatatgtgaatacctcactcgagaatccaagtgccgtgtg
ttcaatacaactgaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaaca
gaagatctctacaatgaaatgaagtggcagaagaaaatcaggaataaccctgcactgttc
tggttctcgaggcacatctctctctgggggagcatttccttcaacctggctgtgttcatc
aatttagctgttgctctcttctacccatttggggatgatggagatgaaggtacactttct
ccattgttctcggttcttctttggatagcagttgcgatctgcacatctatgctgtttttc
ttctccaagcctgtgggtattcggccgtttcttgtatcaataatgctcagatcaatatat
acaataggtcttgggcctacattaatacttcttggtgcagctaatctttgtaataaaatt
gtttttctggtgagttttgttggaaatcgtggcacgttcacccgtgggtaccgagcagtc
atcctggatatggcctttctctatcacgtggcgtatgtcctggtttgcatgctgggcctt
tttgtccatgaattcttctatagcttcctgctttttgatttggtgtacagggaagagact
ttgctgaatgtcataaaaagtgtcacacgaaatggccgctctattattctaactgcagtc
ctggctctcatcctcgtctacctgttttccattattgggttcctttttttgaaggatgac
ttcactatggaagttgataggctgaaaaaccgaactcctgttacaggcagtcatcaagtg
cctactatgactttaactaccatgatggaagcatgtgccaaggagaactgttcacccaca
attccagcttcaaatacagctgatgaagagtatgaagatggaattgaaaggacgtgtgac
actctccttatgtgcattgtcaccgtgctgaaccagggcctcaggaatggcggtggtgtg
ggggatgtgctaagaaggccatcgaaagatgagcccttgtttgctgcccgagtggtttat
gaccttcttttttatttcattgttatcattattgttctgaacttgatttttggtgttatc
atcgatacttttgctgatctcagaagcgaaaaacagaaaaaagaagaaattctaaagaca
acttgtttcatctgtggacttgagagagacaagtttgataataaaacggtttcatttgag
gagcacattaagtcagaacacaatatgtggcattatttgtacttcatagtcctggtgaaa
gttaaagacccaacagaatacactggacctgaaagttatgtggctcaaatgattgtggag
aagaatttggattggtttcctcggatgcgagccatgtccctcgttagcaatgaaggcgac
agtgagcaaaatgaaattcggagccttcaggagaagttggaatcgaccatgagtctggtc
aaacagctgtcgggtcagctggcggagctcaaggagcagatgacagaacaaaggaagaat
aagcagagactgggcttcctcggatcaaacacaccccatgtgaatcatcacatgccacca
cactga

KEGG   Homo sapiens (human): 3710Help
Entry
3710              CDS       T01001                                 

Gene name
ITPR3, IP3R, IP3R3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04114  Oocyte meiosis
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
Disease
H00408  Type 1 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    3710 (ITPR3)
   04020 Calcium signaling pathway
    3710 (ITPR3)
   04070 Phosphatidylinositol signaling system
    3710 (ITPR3)
   04022 cGMP-PKG signaling pathway
    3710 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    3710 (ITPR3)
   04210 Apoptosis
    3710 (ITPR3)
   04218 Cellular senescence
    3710 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    3710 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    3710 (ITPR3)
   04621 NOD-like receptor signaling pathway
    3710 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    3710 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    3710 (ITPR3)
   04922 Glucagon signaling pathway
    3710 (ITPR3)
   04912 GnRH signaling pathway
    3710 (ITPR3)
   04915 Estrogen signaling pathway
    3710 (ITPR3)
   04921 Oxytocin signaling pathway
    3710 (ITPR3)
   04918 Thyroid hormone synthesis
    3710 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    3710 (ITPR3)
   04924 Renin secretion
    3710 (ITPR3)
   04925 Aldosterone synthesis and secretion
    3710 (ITPR3)
   04927 Cortisol synthesis and secretion
    3710 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    3710 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    3710 (ITPR3)
   04971 Gastric acid secretion
    3710 (ITPR3)
   04972 Pancreatic secretion
    3710 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    3710 (ITPR3)
   04725 Cholinergic synapse
    3710 (ITPR3)
   04728 Dopaminergic synapse
    3710 (ITPR3)
   04726 Serotonergic synapse
    3710 (ITPR3)
   04720 Long-term potentiation
    3710 (ITPR3)
   04730 Long-term depression
    3710 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    3710 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    3710 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    3710 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    3710 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    3710 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    3710 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    3710 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3710 (ITPR3)
   05163 Human cytomegalovirus infection
    3710 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3710 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3710 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3710 (ITPR3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     3710 (ITPR3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  IP3 receptor
   3710 (ITPR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 3710
NCBI-ProteinID: NP_002215
OMIM: 147267
HGNC: 6182
Ensembl: ENSG00000096433
Vega: OTTHUMG00000014532
Pharos: Q14573(Tchem)
UniProt: Q14573 A6H8K3 Q59ES2
LinkDB All DBs
Position
6p21.31
AA seq 2671 aa AA seqDB search
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGMGAQGRTGRRNAGEKIKYCLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQVFGILKAPFREKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIRTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFSAPSLSAGASAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAILLPMDLDAHISSMLSSGASCAA
AAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQS
SEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPNNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGLSVPEVLEEDRELDSTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCISR
NT seq 8016 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatgtccagctttcttcacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagccc
gcggccggggacctggacaacccccctaagaagttccgtgactgcctcttcaaggtgtgc
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagactaagcaggac
aaggagaagatcgctgatgtggtgttgctgcagaagctgcagcatgcggcgcagatggag
cagaagcaaaatgacacggagaacaagaaggtgcatggggatgtcgtgaagtatggcagt
gtgatccagctcctgcacatgaagagcaacaagtacctgacagtgaacaagcggcttccg
gccttgctggagaagaacgccatgcgggtgactctggatgccacaggcaacgagggttcc
tggctcttcatccagcccttctggaagctgcggagcaacggggacaacgtggtcgtgggg
gacaaggtgatcctgaatcctgtcaatgccgggcagcctctgcatgccagcaattacgag
ctcagcgacaacgccggctgcaaggaggtcaattctgtgaactgcaacaccagctggaag
atcaacctgtttatgcagtttcgggaccacctggaggaggtgttgaaagggggagacgtg
gtgcggctgttccatgcggagcaggagaagttcctgacgtgtgacgagtacaagggcaag
ctgcaggtgttcctgcgaactacactgcgccagtctgccacctcggccaccagctccaat
gctctctgggaggtggaggtggtccaccacgacccctgccgtggaggagctgggcactgg
aatggcttgtaccgcttcaagcacctggctacaggcaactacctggctgctgaggagaac
cccagttacaaaggtgatgcctcagatcccaaggcagcaggaatgggggcacagggccgc
acaggccgcaggaatgctggggagaagatcaagtactgcctggtggctgtgcctcatggc
aatgacatcgcctctctctttgagctggaccccaccaccttgcagaaaaccgactctttc
gtgccccggaactcgtacgtccggctgcggcacctctgcaccaacacgtggattcagagc
accaatgtgcccattgacatcgaggaggagcggcccatccggctcatgctgggcacctgc
cccaccaaggaggacaaggaggcctttgccatcgtgtcagtgcccgtgtctgagatccga
gacctggactttgccaatgacgccagctccatgctggccagtgccgtggagaaactcaac
gagggcttcatcagccagaatgaccgcaggtttgtcatccagctgctggaagacctggtg
ttctttgtcagcgatgtccccaacaatgggcagaatgtcctggacatcatggtcactaag
cccaaccgggaacggcagaagctgatgagggagcagaacatcctcaaacaggtctttggc
attctgaaggccccgttccgtgagaaggggggtgaaggtcccctggtgcggctggaggag
ctgtcagaccagaagaacgccccctaccagcacatgttccgcctgtgctaccgcgtgttg
cggcattcccaggaggactaccgcaagaaccaggagcacattgccaagcagtttgggatg
atgcagtcccagattggctacgacatcctggccgaggacaccatcactgccctgctgcac
aacaaccgcaagctcctggaaaagcacatcaccaagaccgaggtggagaccttcgtcagc
cttgtgcgcaagaaccgggagcccaggttcctggactacctctctgacctgtgtgtgtcc
aaccacatcgccatccccgtcacccaagagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatccggaccgagcttcggcccgtgaaggagatggcccaatcccac
gagtacctgagcatcgagtactcagaagaggaagtgtggctcacgtggactgacaagaat
aacgagcatcatgagaagagtgtgaggcagctggcccaggaggcgcgggccggcaacgcc
cacgacgagaatgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ttggaccgccagtacttggccatcgacgagatctcccagcagctgggcgtggacctgatt
ttcctgtgcatggcagacgagatgctgccctttgacctgcgcgcctccttctgccacctg
atgctgcacgtgcacgtggaccgtgacccccaggagctggtcacgccggtcaagtttgcc
cgtctctggactgagatccccacagccatcaccatcaaggactatgattccaacctcaac
gcgtcccgagatgacaagaagaacaagtttgccaacaccatggagttcgtggaggactac
ctcaacaatgtagtcagcgaggccgtgccctttgccaacgaggagaagaacaagctcact
tttgaggtggtcagcctggcgcacaatctcatctacttcggcttctacagcttcagcgag
ctgctgcggctcactcgcacactgctgggcatcatcgactgtgtgcaggggcccccggcc
atgctgcaggcctatgaggaccccggtggcaagaatgtgcggcggtccatccagggcgtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtccgtcttcagtgcccccagc
ctgtctgctggggccagtgctgctgagccgctggacagaagcaagtttgaggagaatgag
gacattgtggtgatggagaccaagctgaagatcctggaaatccttcagttcatcctcaat
gtccgcctggattaccgcatatcctacctgctgtctgtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacagtggggctgatggcacagcccctgccttcgactctaccact
gccaacatgaacctggatcgcatcggggagcaggcggaggccatgtttggagtggggaag
acaagcagcatgctggaggtggatgacgagggcggccgcatgttcctgcgcgtgctcatc
cacctcaccatgcacgactatgcgccgctggtctcgggtgccctgcagctgctcttcaag
cacttcagccagcgccaggaggccatgcacaccttcaagcaggttcagctgctgatctca
gcgcaggacgtggagaactacaaggtgatcaagtcggagctggaccggctgcggaccatg
gtggagaagtcagagctgtgggtggacaagaagggcagtggcaagggtgaggaggtggag
gcaggcgccgccaaggacaagaaagagcgtcccacggacgaggagggctttctgcaccca
ccaggggagaaaagcagtgagaactaccagatcgtcaagggcatcctggaaaggctgaac
aagatgtgcggggttggggagcaaatgaggaagaagcagcaacggctgctgaagaacatg
gatgcccacaaggtcatgctggacctgctgcagatcccctatgacaagggtgatgccaag
atgatggagatcctgcgctacacgcaccagttcctgcagaagttctgtgcagggaacccc
ggcaaccaggccctgctgcacaaacacctgcacctcttcctcacgccagggctcctggag
gcagagaccatgcagcacatcttcctgaacaactatcagctctgctccgagatcagcgag
cctgtgttgcagcacttcgtgcacctgctggccacgcacgggcgccatgtgcagtacctg
gacttcctgcacaccgtcattaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgaccaatgcaggtgacgatgtggtcgtgttctacaatgataaggca
tcgctggcccacctgctggacatgatgaaggccgcccgcgacggcgtggaggaccacagc
cccctcatgtaccacatttccctggtggacctgctggccgcctgtgccgagggcaaaaac
gtctacactgagatcaagtgcacctccctgctgccgctggaggacgtggtgtctgtggtg
acgcatgaggactgcatcactgaggtgaaaatggcctatgtgaacttcgtgaaccactgc
tacgtggacacggaggtggagatgaaggagatctacaccagcaaccacatctggacgctc
tttgagaacttcaccctggacatggcccgggtctgcagcaagcgtgagaagcgcgtggct
gaccccaccttggagaagtacgtgctgagcgttgtgctggacaccatcaacgccttcttc
agctccccattctctgagaacagcacttccctgcagacacaccagacgattgtggtgcag
ctgctgcagtctaccacacgcctcctcgagtgtccgtggctacagcagcagcacaagggc
tccgtggaggcctgcatccggaccctcgccatggtggccaagggccgggccatcttgctg
cccatggacctggatgcccacatcagctcgatgctcagcagtggagccagctgtgcagct
gccgcccagcggaacgcctccagctacaaggcaaccacgcgggccttcccccgcgtcacc
cccaccgccaaccagtgggactacaagaacatcattgagaagctgcaggacatcatcaca
gccctggaggagcggctgaagcccctggtacaggctgagctgtccgtgctggtggatgtc
ctgcactggcctgagctgctcttcctggagggcagtgaggcctaccagcgctgcgagagt
gggggcttcctgtccaagctgatccagcacaccaaggacctcatggagtcggaggagaag
ctgtgcatcaaggtgctgcggaccctgcagcagatgctgctcaagaagaccaagtacggg
gaccggggcaaccagctgcgcaagatgctgctgcaaaactacctccagaaccggaagtcc
acctcgcggggggaccttcccgaccccataggcactggcctggacccagactggtcggca
atcgcagccacccagtgccggctggacaaggagggggccaccaagttggtatgcgacctc
atcaccagcaccaagaacgagaagatcttccaggagagcatcggcctggccatccacctg
ctggatggtggcaacacagagatccagaaatccttccacaacctgatgatgagtgacaag
aagtcagagcgcttcttcaaggtgctgcacgaccgcatgaagcgggcccagcaggagacc
aagtccacggtggcagtcaacatgaatgacctgggcagccagccacatgaggaccgcgag
ccagtcgaccccaccaccaaaggccgcgtggcctccttctcgatacctggctcctcatcc
cgctactcgctgggccccagcctgcgccgggggcacgaggtgagcgaacgtgtgcagagc
agtgagatgggcacatccgtgctcatcatgcagcccatcctgcgctttctgcagctgctg
tgtgagaaccacaaccgggacctgcagaacttcctgcgctgtcagaacaacaaaaccaac
tacaacttggtatgcgagacgctgcagttcctggacatcatgtgcggcagcaccacgggc
ggcctggggctgctggggctctacatcaatgaggacaacgtgggcctcgtcatccagacc
ttggagaccctcactgagtactgccagggcccctgccatgagaaccagacttgcattgtg
actcacgagtccaatggcatagacatcatcaccgcactgatcctcaatgacatcagcccc
ctgtgcaagtaccgcatggatctggtgctgcagctcaaggacaatgcctccaagctgctc
ctggctctgatggagagccggcatgacagtgaaaatgctgagcgaatcctcatcagcctg
cggccccaggagctggtggacgtcatcaagaaggcctacctgcaggaggaagagcgtgag
aactcggaggtgagcccacgtgaagtgggccataacatctatatcctggcgctgcagctc
tccaggcacaataaacagctgcagcacctgctgaagccggtgaagcgcattcaagaggag
gaggccgagggtatctcttccatgctcagcctcaacaacaagcagctgtcacagatgctc
aagtcctcagcgccagcacaggaggaggaggaagaccccctggcctactatgagaaccac
acgtcccagatcgagattgtgcggcaggaccgcagcatggagcagatcgtgttcccagtg
cccggcatctgccagttcctgacggaggaaaccaagcaccggctcttcaccactactgag
caggacgagcagggcagcaaagtgagcgacttcttcgaccagtcctccttcctgcacaac
gagatggagtggcagcgcaagctccgcagcatgccgctgatctactggttctcccgccgc
atgaccctgtggggcagcatctccttcaacctggccgtgtttatcaacatcatcattgcc
ttcttctacccttacatggagggcgcgtccacaggcgtgctggactcccctctcatctca
ttgctcttctggatcctcatctgcttctccatcgcggccctgttcaccaagcgctacagc
atccgccccctcatcgtggcgctcatcctgcgctccatctactatctgggcatcgggccc
acactcaacatcctgggtgccctcaatctgaccaacaagatcgtgtttgtggtgagcttc
gtgggcaaccgtggcaccttcatccggggctataaggccatggtcatggacatggaattc
ctctaccacgtgggctacatcctgaccagtgtcctgggcctctttgctcatgagctgttc
tacagcatcctgctctttgacctcatctaccgcgaggagacgctgttcaacgtcatcaag
agtgtgacccgcaatggccgctccatcctgctgacagccctgctggccctcatcctggtc
tacctcttctccatcgtcggcttcctcttcctcaaggatgacttcattctcgaggtcgac
cggctgcccaacaaccactccacagccagccccctggggatgccacatggagctgctgca
tttgtggacacctgcagtggggacaagatggactgtgtctcagggctctcggtgcctgag
gtcctggaagaggacagggagctggacagcacagagcgggcctgtgacactctgttgatg
tgcatcgtcactgtcatgaaccatgggctacgcaacggtggtggcgtgggcgacattctc
cgcaagccctccaaagatgagtctctcttcccagcccgagtggtctatgacctcctgttc
ttcttcatcgtcatcatcattgtgctgaacctcatctttggggtaatcatcgacaccttc
gctgacctgcgtagtgagaagcagaagaaggaggagattcttaagacgacatgcttcatc
tgtggtctggagagggacaagtttgataacaagacagtgtcatttgaggaacacatcaag
ctggagcacaacatgtggaactacttgtacttcattgtgctggtccgcgtgaagaacaag
accgactacacgggccctgagagctacgtggcccagatgatcaagaacaagaacctggac
tggttcccccggatgcgggccatgtcccttgtcagcaatgagggcgagggggagcagaat
gagattcggattctccaggacaagctcaactccaccatgaagctggtgtcccacctcact
gcccagctcaacgagctcaaggagcagatgacggagcagcggaaacgcaggcaacgccta
ggctttgtggatgtccagaactgcattagccgctga

DBGET integrated database retrieval system