KEGG   Homo sapiens (human): 3725Help
Entry
3725              CDS       T01001                                 

Gene name
JUN, AP-1, AP1, c-Jun, p39
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04024  cAMP signaling pathway
hsa04137  Mitophagy - animal
hsa04210  Apoptosis
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05224  Breast cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06224  CXCR signaling
nt06263  Hepatocellular carcinoma
  Element
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00439  HIV Nef to TLR2/4-MAPK signaling pathway
N00446  TNF-JNK signaling pathway
N00447  HIV Vpr/Tat to TNF-JNK signaling pathway
N00503  HTLV-1 Tax to TNF-JNK signaling pathway
N00543  HBV HBx to JNK signaling pathway
N00545  HBV HBx to ERK signaling pathway
N00547  HBV LHBs to PKC-ERK signaling pathway
N00551  HBV HBs to TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3725 (JUN)
   04012 ErbB signaling pathway
    3725 (JUN)
   04310 Wnt signaling pathway
    3725 (JUN)
   04668 TNF signaling pathway
    3725 (JUN)
   04024 cAMP signaling pathway
    3725 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    3725 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    3725 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3725 (JUN)
   04530 Tight junction
    3725 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3725 (JUN)
   04621 NOD-like receptor signaling pathway
    3725 (JUN)
   04625 C-type lectin receptor signaling pathway
    3725 (JUN)
   04660 T cell receptor signaling pathway
    3725 (JUN)
   04658 Th1 and Th2 cell differentiation
    3725 (JUN)
   04659 Th17 cell differentiation
    3725 (JUN)
   04657 IL-17 signaling pathway
    3725 (JUN)
   04662 B cell receptor signaling pathway
    3725 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    3725 (JUN)
   04915 Estrogen signaling pathway
    3725 (JUN)
   04921 Oxytocin signaling pathway
    3725 (JUN)
   04926 Relaxin signaling pathway
    3725 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    3725 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    3725 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3725 (JUN)
   05203 Viral carcinogenesis
    3725 (JUN)
   05231 Choline metabolism in cancer
    3725 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    3725 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    3725 (JUN)
   05211 Renal cell carcinoma
    3725 (JUN)
   05224 Breast cancer
    3725 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3725 (JUN)
   05321 Inflammatory bowel disease (IBD)
    3725 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    3725 (JUN)
   05031 Amphetamine addiction
    3725 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    3725 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3725 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3725 (JUN)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3725 (JUN)
   05130 Pathogenic Escherichia coli infection
    3725 (JUN)
   05132 Salmonella infection
    3725 (JUN)
   05135 Yersinia infection
    3725 (JUN)
   05133 Pertussis
    3725 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3725 (JUN)
   05170 Human immunodeficiency virus 1 infection
    3725 (JUN)
   05162 Measles
    3725 (JUN)
   05161 Hepatitis B
    3725 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3725 (JUN)
   05169 Epstein-Barr virus infection
    3725 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    3725 (JUN)
   05142 Chagas disease (American trypanosomiasis)
    3725 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    3725 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3725 (JUN)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3725 (JUN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha Jnk-SapK_ap_N FlaC_arch NBP1 TSC22 DUF3450 TFIIA
Motif
Other DBs
NCBI-GeneID: 3725
NCBI-ProteinID: NP_002219
OMIM: 165160
HGNC: 6204
Ensembl: ENSG00000177606
Vega: OTTHUMG00000008376
Pharos: P05412(Tchem)
UniProt: P05412
LinkDB All DBs
Structure
PDB: 

Position
1p32.1
AA seq 331 aa AA seqDB search
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg
tccgagagcggaccttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagatgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcaacggggca
ggcatggtggctcccgcggtagcctcggtggcagggggcagcggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgcaaacctcagcaacttcaacccaggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcaccacctgccccagcagatgcccgtgcagcacccg
cggctgcaggccctgaaggaggagcctcagacagtgcccgagatgcccggcgagacaccg
cccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagaggaagcgcatg
aggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatcgcccggctg
gaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacggccaacatg
ctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagtgggtgc
caactcatgctaacgcagcagttgcaaacattttga

KEGG   Homo sapiens (human): 5599Help
Entry
5599              CDS       T01001                                 

Gene name
MAPK8, JNK, JNK-46, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1, SAPK1c
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06224  CXCR signaling
nt06263  Hepatocellular carcinoma
  Element
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00446  TNF-JNK signaling pathway
N00447  HIV Vpr/Tat to TNF-JNK signaling pathway
N00503  HTLV-1 Tax to TNF-JNK signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N00543  HBV HBx to JNK signaling pathway
N00551  HBV HBs to TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
Drug target
Tanzisertib: D10168
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5599 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5599 (MAPK8)
   04010 MAPK signaling pathway
    5599 (MAPK8)
   04012 ErbB signaling pathway
    5599 (MAPK8)
   04310 Wnt signaling pathway
    5599 (MAPK8)
   04668 TNF signaling pathway
    5599 (MAPK8)
   04068 FoxO signaling pathway
    5599 (MAPK8)
   04071 Sphingolipid signaling pathway
    5599 (MAPK8)
   04024 cAMP signaling pathway
    5599 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5599 (MAPK8)
   04137 Mitophagy - animal
    5599 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    5599 (MAPK8)
   04215 Apoptosis - multiple species
    5599 (MAPK8)
   04217 Necroptosis
    5599 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5599 (MAPK8)
   04530 Tight junction
    5599 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5599 (MAPK8)
   04621 NOD-like receptor signaling pathway
    5599 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    5599 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    5599 (MAPK8)
   04660 T cell receptor signaling pathway
    5599 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    5599 (MAPK8)
   04659 Th17 cell differentiation
    5599 (MAPK8)
   04657 IL-17 signaling pathway
    5599 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    5599 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5599 (MAPK8)
   04920 Adipocytokine signaling pathway
    5599 (MAPK8)
   04912 GnRH signaling pathway
    5599 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    5599 (MAPK8)
   04917 Prolactin signaling pathway
    5599 (MAPK8)
   04926 Relaxin signaling pathway
    5599 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    5599 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    5599 (MAPK8)
   04722 Neurotrophin signaling pathway
    5599 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5599 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5599 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5599 (MAPK8)
   05231 Choline metabolism in cancer
    5599 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5599 (MAPK8)
   05212 Pancreatic cancer
    5599 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5599 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5599 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5599 (MAPK8)
   04931 Insulin resistance
    5599 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5599 (MAPK8)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5599 (MAPK8)
   05130 Pathogenic Escherichia coli infection
    5599 (MAPK8)
   05132 Salmonella infection
    5599 (MAPK8)
   05131 Shigellosis
    5599 (MAPK8)
   05135 Yersinia infection
    5599 (MAPK8)
   05133 Pertussis
    5599 (MAPK8)
   05152 Tuberculosis
    5599 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5599 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    5599 (MAPK8)
   05162 Measles
    5599 (MAPK8)
   05161 Hepatitis B
    5599 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5599 (MAPK8)
   05169 Epstein-Barr virus infection
    5599 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5599 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    5599 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5599 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5599 (MAPK8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5599 (MAPK8)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5599 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 DUF530
Motif
Other DBs
NCBI-GeneID: 5599
NCBI-ProteinID: NP_001265476
OMIM: 601158
HGNC: 6881
Ensembl: ENSG00000107643
Vega: OTTHUMG00000018172
Pharos: P45983(Tchem)
UniProt: P45983 A1L4K2
LinkDB All DBs
Structure
PDB: 

Position
10q11.22
AA seq 427 aa AA seqDB search
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgcgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgattgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttatgtagtgactcgctactacagagcacccgaggtcatccttggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcatcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctctgatacagacagcagtctagaagcagcagct
gggcctctgggctgctgtagatga

KEGG   Homo sapiens (human): 5601Help
Entry
5601              CDS       T01001                                 

Gene name
MAPK9, JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, SAPK1a, p54a, p54aSAPK
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06224  CXCR signaling
nt06263  Hepatocellular carcinoma
  Element
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00446  TNF-JNK signaling pathway
N00447  HIV Vpr/Tat to TNF-JNK signaling pathway
N00503  HTLV-1 Tax to TNF-JNK signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N00543  HBV HBx to JNK signaling pathway
N00551  HBV HBs to TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
Drug target
Tanzisertib: D10168
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5601 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5601 (MAPK9)
   04010 MAPK signaling pathway
    5601 (MAPK9)
   04012 ErbB signaling pathway
    5601 (MAPK9)
   04310 Wnt signaling pathway
    5601 (MAPK9)
   04668 TNF signaling pathway
    5601 (MAPK9)
   04068 FoxO signaling pathway
    5601 (MAPK9)
   04071 Sphingolipid signaling pathway
    5601 (MAPK9)
   04024 cAMP signaling pathway
    5601 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5601 (MAPK9)
   04137 Mitophagy - animal
    5601 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    5601 (MAPK9)
   04215 Apoptosis - multiple species
    5601 (MAPK9)
   04217 Necroptosis
    5601 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5601 (MAPK9)
   04530 Tight junction
    5601 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5601 (MAPK9)
   04621 NOD-like receptor signaling pathway
    5601 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    5601 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    5601 (MAPK9)
   04660 T cell receptor signaling pathway
    5601 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    5601 (MAPK9)
   04659 Th17 cell differentiation
    5601 (MAPK9)
   04657 IL-17 signaling pathway
    5601 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    5601 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5601 (MAPK9)
   04920 Adipocytokine signaling pathway
    5601 (MAPK9)
   04912 GnRH signaling pathway
    5601 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    5601 (MAPK9)
   04917 Prolactin signaling pathway
    5601 (MAPK9)
   04926 Relaxin signaling pathway
    5601 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    5601 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    5601 (MAPK9)
   04722 Neurotrophin signaling pathway
    5601 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5601 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5601 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5601 (MAPK9)
   05231 Choline metabolism in cancer
    5601 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5601 (MAPK9)
   05212 Pancreatic cancer
    5601 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5601 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5601 (MAPK9)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5601 (MAPK9)
   04931 Insulin resistance
    5601 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5601 (MAPK9)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5601 (MAPK9)
   05130 Pathogenic Escherichia coli infection
    5601 (MAPK9)
   05132 Salmonella infection
    5601 (MAPK9)
   05131 Shigellosis
    5601 (MAPK9)
   05135 Yersinia infection
    5601 (MAPK9)
   05133 Pertussis
    5601 (MAPK9)
   05152 Tuberculosis
    5601 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5601 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    5601 (MAPK9)
   05162 Measles
    5601 (MAPK9)
   05161 Hepatitis B
    5601 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5601 (MAPK9)
   05169 Epstein-Barr virus infection
    5601 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5601 (MAPK9)
   05142 Chagas disease (American trypanosomiasis)
    5601 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5601 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5601 (MAPK9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5601 (MAPK9)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5601 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5601
NCBI-ProteinID: NP_002743
OMIM: 602896
HGNC: 6886
Ensembl: ENSG00000050748
Vega: OTTHUMG00000130934
Pharos: P45984(Tchem)
UniProt: P45984
LinkDB All DBs
Structure
PDB: 

Position
5q35.3
AA seq 424 aa AA seqDB search
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagtaaatgtgacagtcagttttatagtgtgcaagtggcagactcaaccttc
actgtcctaaaacgttaccagcagctgaaaccaattggctctggggcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaaccaaactcatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagctggatcatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacattgttgtgaaa
tcagactgcaccctgaagatccttgactttggcctggcccggacagcgtgcactaacttc
atgatgaccccttacgtggtgacacggtactaccgggcgcccgaagtcatcctgggtatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcagtggaataaagttattgagcag
ctgggaacaccatcagcagagttcatgaagaaacttcagccaactgtgaggaattatgtc
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatctgagcgagacaaaataaaaacaagtcaagccagagatctgttatcaaaa
atgttagtgattgatcctgacaagcggatctctgtagacgaagctctgcgtcacccatac
atcactgtttggtatgaccccgccgaagcagaagccccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttctcagtcttcatcgatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtcttgatgcctcgacgggacccctt
gaaggctgtcgatga

KEGG   Homo sapiens (human): 5602Help
Entry
5602              CDS       T01001                                 

Gene name
MAPK10, JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06224  CXCR signaling
nt06263  Hepatocellular carcinoma
  Element
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00446  TNF-JNK signaling pathway
N00447  HIV Vpr/Tat to TNF-JNK signaling pathway
N00503  HTLV-1 Tax to TNF-JNK signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N00543  HBV HBx to JNK signaling pathway
N00551  HBV HBs to TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
Disease
H00606  Early infantile epileptic encephalopathy
Drug target
Tanzisertib: D10168
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5602 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5602 (MAPK10)
   04010 MAPK signaling pathway
    5602 (MAPK10)
   04012 ErbB signaling pathway
    5602 (MAPK10)
   04310 Wnt signaling pathway
    5602 (MAPK10)
   04668 TNF signaling pathway
    5602 (MAPK10)
   04068 FoxO signaling pathway
    5602 (MAPK10)
   04071 Sphingolipid signaling pathway
    5602 (MAPK10)
   04024 cAMP signaling pathway
    5602 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5602 (MAPK10)
   04137 Mitophagy - animal
    5602 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    5602 (MAPK10)
   04215 Apoptosis - multiple species
    5602 (MAPK10)
   04217 Necroptosis
    5602 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5602 (MAPK10)
   04530 Tight junction
    5602 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5602 (MAPK10)
   04621 NOD-like receptor signaling pathway
    5602 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    5602 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    5602 (MAPK10)
   04660 T cell receptor signaling pathway
    5602 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    5602 (MAPK10)
   04659 Th17 cell differentiation
    5602 (MAPK10)
   04657 IL-17 signaling pathway
    5602 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    5602 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5602 (MAPK10)
   04920 Adipocytokine signaling pathway
    5602 (MAPK10)
   04912 GnRH signaling pathway
    5602 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    5602 (MAPK10)
   04917 Prolactin signaling pathway
    5602 (MAPK10)
   04926 Relaxin signaling pathway
    5602 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    5602 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    5602 (MAPK10)
   04722 Neurotrophin signaling pathway
    5602 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5602 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5602 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5602 (MAPK10)
   05231 Choline metabolism in cancer
    5602 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5602 (MAPK10)
   05212 Pancreatic cancer
    5602 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5602 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5602 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5602 (MAPK10)
   04931 Insulin resistance
    5602 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5602 (MAPK10)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5602 (MAPK10)
   05130 Pathogenic Escherichia coli infection
    5602 (MAPK10)
   05132 Salmonella infection
    5602 (MAPK10)
   05131 Shigellosis
    5602 (MAPK10)
   05135 Yersinia infection
    5602 (MAPK10)
   05133 Pertussis
    5602 (MAPK10)
   05152 Tuberculosis
    5602 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5602 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    5602 (MAPK10)
   05162 Measles
    5602 (MAPK10)
   05161 Hepatitis B
    5602 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5602 (MAPK10)
   05169 Epstein-Barr virus infection
    5602 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5602 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    5602 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5602 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5602 (MAPK10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5602 (MAPK10)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5602 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5602
NCBI-ProteinID: NP_001304996
OMIM: 602897
HGNC: 6872
Ensembl: ENSG00000109339
Vega: OTTHUMG00000130604
Pharos: P53779(Tchem)
UniProt: P53779 A0A286YF97
LinkDB All DBs
Structure
PDB: 

Position
4q21.3
AA seq 464 aa AA seqDB search
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaacattggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtttgtgcc
gcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacacatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcagatggaa
ttagaccatgagcgaatgtcttacctgctgtaccaaatgttgtgtggcattaagcacctc
cattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttcatgatg
actccatatgtggtgacacgttattacagagcccctgaggtcatcctggggatgggctac
aaggagaacgttgacatgtggtcagtagggtgcatcatgggagaaatgataaaaggtgca
gtgctgtttcctggcactgatcatattgaccagtggaataaggtaattgaacaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcgggactcaccttccccaaactcttcccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctacatcaac
gtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaagcagttg
gatgaaagagaacacacaattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcagaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system