KEGG   Homo sapiens (human): 3727
Entry
3727              CDS       T01001                                 

Gene name
JUND, AP-1
Definition
(RefSeq) JunD proto-oncogene, AP-1 transcription factor subunit
  KO
K04449  transcription factor jun-D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04380  Osteoclast differentiation
hsa04657  IL-17 signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3727 (JUND)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    3727 (JUND)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    3727 (JUND)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    3727 (JUND)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3727 (JUND)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3727 (JUND)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB TSC22 Jnk-SapK_ap_N DUF3450 FlaC_arch Fib_alpha
Other DBs
NCBI-GeneID: 3727
NCBI-ProteinID: NP_005345
OMIM: 165162
HGNC: 6206
Ensembl: ENSG00000130522
Vega: OTTHUMG00000183355
Pharos: P17535(Tbio)
UniProt: P17535
LinkDB
Structure
PDB: 

Position
19p13.11
AA seq 347 aa
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaaacacccttctacggcgatgaggcgctgagcggcctgggcggcggcgccagtggc
agcggcggcagcttcgcgtccccgggccgcttgttccccggggcgcccccgacggccgcg
gccggcagcatgatgaagaaggacgcgctgacgctgagcctgagtgagcaggtggcggca
gcgctcaagcctgcggccgcgccgcctcctacccccctgcgcgccgacggcgcccccagc
gcggcaccccccgacggcctgctcgcctctcccgacctggggctgctgaagctggcctcc
cccgagctcgagcgcctcatcatccagtccaacgggctggtcaccaccacgccgacgagc
tcacagttcctctaccccaaggtggcggccagcgaggagcaggagttcgccgagggcttc
gtcaaggccctggaggatttacacaagcagaaccagctcggcgcgggcgcggccgctgcc
gccgccgccgccgccgccggggggccctcgggcacggccacgggctccgcgccccccggc
gagctggccccggcggcggccgcgcccgaagcgcctgtctacgcgaacctgagcagctac
gcgggcggcgccgggggcgcggggggcgccgcgacggtcgccttcgctgccgaacctgtg
cccttcccgccgccgccacccccaggcgcgttggggccgccgcgcctggctgcgctcaag
gacgagccacagacggtgcccgacgtgccgagcttcggcgagagcccgccgttgtcgccc
atcgacatggacacgcaggagcgcatcaaggcggagcgcaagcggctgcgcaaccgcatc
gccgcctccaagtgccgcaagcgcaagctggagcgcatctcgcgcctggaagagaaagtg
aagaccctcaagagtcagaacacggagctggcgtccacggcgagcctgctgcgcgagcag
gtggcgcagctcaagcagaaagtcctcagccacgtcaacagcggctgccagctgctgccc
cagcaccaggtgcccgcgtactga

DBGET integrated database retrieval system