KEGG   Homo sapiens (human): 3728Help
Entry
3728              CDS       T01001                                 

Gene name
JUP, CTNNG, DP3, DPIII, PDGB, PKGB
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00108  AML1-ETO fusion to transcriptional activtion
N00109  PML-RARA fusion to transcriptional activtion
N00110  PLZF-RARA fusion to transcriptional activtion
Disease
H00293  Arrhythmogenic right ventricular cardiomyopathy
H00669  Naxos disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3728 (JUP)
   05202 Transcriptional misregulation in cancer
    3728 (JUP)
  09162 Cancer: specific types
   05226 Gastric cancer
    3728 (JUP)
   05221 Acute myeloid leukemia
    3728 (JUP)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3728 (JUP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3728 (JUP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3728 (JUP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT V-ATPase_H_N Cnd1 HEAT_2 Atx10homo_assoc Adaptin_N DUF3361 KAP Arm_2 PUL
Motif
Other DBs
NCBI-GeneID: 3728
NCBI-ProteinID: NP_002221
OMIM: 173325
HGNC: 6207
Ensembl: ENSG00000173801
Vega: OTTHUMG00000133494
Pharos: P14923(Tbio)
UniProt: P14923 A0A0S2Z487
LinkDB All DBs
Structure
PDB: 

Position
17q21.2
AA seq 745 aa AA seqDB search
MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTT
YTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDM
DGDYPIDTYSDGLRPPYPTADHMLA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgatgaacctgatggagcagcctatcaaggtgactgagtggcagcagacatac
acctacgactcgggtatccactcgggcgccaacacctgcgtgccctccgtcagcagcaag
ggcatcatggaggaggatgaggcctgcgggcgccagtacacgctcaagaaaaccaccact
tacacccagggggtgccccccagccaaggtgatctggagtaccagatgtccacaacagcc
agggccaaacgggtgcgggaggccatgtgccctggtgtgtcaggcgaggacagctcgctt
ctgctggccacccaggtggaggggcaggccaccaacctgcagcgactggccgagccgtcc
cagctgctcaagtcggccattgtgcatctcatcaactaccaggacgatgccgagctggcc
actcgcgccctgcccgagctcaccaaactgctcaacgacgaggacccggtggtggtgacc
aaggcggccatgattgtgaaccagctgtcgaagaaggaggcgtcgcggcgggccctgatg
ggctcgccccagctggtggccgctgtcgtgcgtaccatgcagaataccagcgacctggac
acagcccgctgcaccaccagcatcctgcacaacctctcccaccaccgggaggggctgctc
gccatcttcaagtcgggtggcatccctgctctggtccgcatgctcagctcccctgtggag
tcggtcctgttctatgccatcaccacgctgcacaacctgctcctgtaccaggagggcgcc
aagatggccgtgcgcctggccgacgggctgcaaaagatggtgcccctgctcaacaagaac
aaccccaagttcctggccatcaccaccgactgcctgcagctcctggcctacggcaaccag
gagagcaagctgatcatcctggccaatggtgggccccaggccctcgtgcagatcatgcgt
aactacagttatgaaaagctgctctggaccaccagtcgtgtgctcaaggtgctatccgtg
tgtcccagcaataagcctgccattgtggaggctggtgggatgcaggccctgggcaagcac
ctgaccagcaacagcccccgcctggtgcagaactgcctgtggaccctgcgcaacctctca
gatgtggccaccaagcaggagggcctggagagtgtgctgaagattctggtgaatcagctg
agtgtggatgacgtcaacgtcctcacctgtgccacgggcacactctccaacctgacatgc
aacaacagcaagaacaagacgctggtgacacagaacagcggtgtggaggctctcatccat
gccatcctgcgtgctggtgacaaggacgacatcacggagcctgccgtctgcgctctgcgc
cacctcactagccgccaccctgaggccgagatggcccagaactctgtgcgtctcaactat
ggcatcccagccatcgtgaagctgctcaaccagcccaaccagtggccactggtcaaggca
accatcggcttgatcaggaatctggccctgtgcccagccaaccatgccccgctgcaggag
gcagcggtcatcccccgcctcgtccaactgctggtgaaggcccaccaggatgcccagcgc
cacgtagctgcaggcacacagcagccctacacggatggtgtgaggatggaggagattgtg
gagggctgcaccggagcactgcacatcctcgcccgggaccccatgaaccgcatggagatc
ttccggctcaacaccattcccctgtttgtgcagctcctgtactcgtcggtggagaacatc
cagcgcgtggctgccggggtgctgtgtgagctggcccaggacaaggaggcggccgacgcc
attgatgcagagggggcctcggccccactcatggagttgctgcactcccgcaacgagggc
actgccacctacgctgctgccgtcctgttccgcatctccgaggacaagaacccagactac
cggaagcgcgtgtccgtggagctcaccaactccctcttcaagcatgacccggctgcctgg
gaggctgcccagagcatgattcccatcaatgagccctatggagatgacatggatgccacc
taccgccccatgtactccagcgatgtgccccttgacccgctggagatgcacatggacatg
gatggagactaccccatcgacacctacagcgacggcctcaggcccccgtaccccactgca
gaccacatgctggcctag

KEGG   Homo sapiens (human): 8900Help
Entry
8900              CDS       T01001                                 

Gene name
CCNA1, CT146
Definition
(RefSeq) cyclin A1
  KO
K06627  cyclin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04152  AMPK signaling pathway
hsa04218  Cellular senescence
hsa04914  Progesterone-mediated oocyte maturation
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05221  Acute myeloid leukemia
Network
nt06130  Cell cycle (viruses)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
nt06275  Acute myeloid leukemia
  Element
N00091  p27-Cell cycle G1/S
N00109  PML-RARA fusion to transcriptional activtion
N00110  PLZF-RARA fusion to transcriptional activtion
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00482  EBV EBNA3C to p27-Cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    8900 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    8900 (CCNA1)
   04218 Cellular senescence
    8900 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8900 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8900 (CCNA1)
   05202 Transcriptional misregulation in cancer
    8900 (CCNA1)
   05203 Viral carcinogenesis
    8900 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    8900 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    8900 (CCNA1)
   05161 Hepatitis B
    8900 (CCNA1)
   05169 Epstein-Barr virus infection
    8900 (CCNA1)
   05165 Human papillomavirus infection
    8900 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    8900 (CCNA1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8900 (CCNA1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    8900 (CCNA1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    8900 (CCNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Motif
Other DBs
NCBI-GeneID: 8900
NCBI-ProteinID: NP_003905
OMIM: 604036
HGNC: 1577
Ensembl: ENSG00000133101
Vega: OTTHUMG00000016733
Pharos: P78396(Tbio)
UniProt: P78396
LinkDB All DBs
Position
13q13.3
AA seq 465 aa AA seqDB search
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA
RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK
ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN
TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT
EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY
EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR
TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV
PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggagaccggctttcccgcaatcatgtaccctggatcttttattgggggctggggagaa
gagtatctcagctgggaaggaccggggctcccagatttcgtcttccagcagcagcccgtg
gagtctgaagcaatgcactgcagcaaccccaagagtggagttgtgctggctacagtggcc
cgaggtcccgatgcttgtcagatactcaccagagccccgctgggccaggatcccccgcag
aggacagtgctagggctgctaactgcaaatgggcagtacaggaggacctgtggccagggg
atcacaagaatcaggtgttattctggatcagaaaatgccttccctccagctggaaagaaa
gcactccctgactgtggggtccaagagccccccaagcaagggtttgacatctacatggat
gaactagagcagggggacagagacagctgctcggtcagagaggggatggcatttgaggat
gtgtatgaagtagacaccggcacactcaagtcagacctgcacttcctgctggatttcaac
acagtttcccctatgctggtagattcatctctcctctcccagtctgaagatatatccagt
cttggcacagatgtgataaatgtgactgaatatgctgaagaaatttatcagtaccttagg
gaagctgaaataaggcacagacccaaagcacactacatgaagaagcagccagacatcacg
gaaggcatgcgcacgattctggtggactggctggtggaggttggggaagaatataaactt
cgagcagagaccctgtatctggctgtcaacttcctggacaggttcctttcatgtatgtct
gttctgagagggaaactgcagctcgtaggaacagcagctatgcttttggcttcgaaatat
gaagagatatatcctcctgaagtagacgagtttgtctatatcaccgatgatacatacaca
aaacgacaactgttaaaaatggaacacttgcttctgaaagttctagcttttgatctgaca
gtaccaaccaccaaccagtttctccttcagtacttgaggcgacaaggagtgtgcgtcagg
actgagaacctggctaagtacgtagcagagctgagtctacttgaagcagatccattcttg
aaatatcttccttcactgatagctgcagcagctttttgcctggcaaactatactgtgaac
aagcacttttggccagaaacccttgctgcatttacagggtattcattaagtgaaattgtg
ccttgcctgagtgagcttcataaagcgtaccttgatataccccatcgacctcagcaagca
attagggagaagtacaaggcttcaaagtacctgtgtgtgtccctcatggagccacctgca
gttcttcttctacaataa

DBGET integrated database retrieval system