KEGG   Homo sapiens (human): 3741
Entry
3741              CDS       T01001                                 

Gene name
KCNA5, ATFB7, HCK1, HK2, HPCN1, KV1.5, PCN1
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 5
  KO
K04878  potassium voltage-gated channel Shaker-related subfamily A member 5
Organism
hsa  Homo sapiens (human)
Disease
H00731  Atrial fibrillation
Drug target
Amifampridine: D10228<US> D10689<US>
Bepridil (DG00333): D00631<JP> D07520
Fampridine: D04127<US>
Vernakalant: D06665
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3741 (KCNA5)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3741 (KCNA5)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel DctQ
Other DBs
NCBI-GeneID: 3741
NCBI-ProteinID: NP_002225
OMIM: 176267
HGNC: 6224
Ensembl: ENSG00000130037
Vega: OTTHUMG00000168232
Pharos: P22460(Tclin)
UniProt: P22460
LinkDB
Position
12p13.32
AA seq 613 aa
MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDA
DSGVRPLPPLPDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQ
RVHINISGLRFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQ
SGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIF
EYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPAPGANG
SGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAGFSRNIMNII
DVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGL
QILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTT
VGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQG
TQSQGPGLDRGVQRKVSGSRGSFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSL
YALCLDTSRETDL
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggagatcgccctggtgcccctggagaacggcggtgccatgaccgtcagaggaggcgat
gaggcccgggcaggctgcggccaggccacagggggagagctccagtgtcccccgacggct
gggctcagcgatgggcccaaggagccggcgccaaaggggcgcggcgcgcagagagacgcg
gactcgggagtgcggcccttgcctccgctgccggacccgggagtgcggcccttgcctccg
ctgccagaggagctgccacggcctcgacggccgcctcccgaggacgaggaggaagaaggc
gatcccggcctgggcacggtggaggaccaggctctgggcacggcgtccctgcaccaccag
cgcgtccacatcaacatctccgggctgcgctttgagacgcagctgggcaccctggcgcag
ttccccaacacactcctgggggaccccgccaagcgcctgcgctacttcgaccccctgagg
aacgagtacttcttcgaccgcaaccggcccagcttcgacggtatcctctactactaccag
tccgggggccgcctgcggaggccggtcaacgtctccctggacgtgttcgcggacgagata
cgcttctaccagctgggggacgaggccatggagcgcttccgcgaggatgagggcttcatt
aaagaagaggagaagcccctgccccgcaacgagttccagcgccaggtgtggcttatcttc
gagtatccggagagctctgggtccgcgcgggccatcgccatcgtctcggtcttggttatc
ctcatctccatcatcaccttctgcttggagaccctgcctgagttcagggatgaacgtgag
ctgctccgccaccctccggcgccccaccagcctcccgcgcccgcccctggggccaacggc
agcggggtcatggccccgccctctggccctacggtggcaccgctcctgcccaggaccctg
gccgaccccttcttcatcgtggagaccacgtgcgtcatctggttcaccttcgagctgctc
gtgcgcttcttcgcctgccccagcaaggcagggttctcccggaacatcatgaacatcatc
gatgtggtggccatcttcccctacttcatcaccctgggcaccgaactggcagagcagcag
ccagggggtggaggaggcggccagaatgggcagcaggccatgtccctggccatcctccga
gtcatccgcctggtccgggtgttccgcatcttcaagctctcccgccactccaaggggctg
cagatcctgggcaagaccttgcaggcctccatgagggagctggggctgctcatcttcttc
ctcttcatcggggtcatcctcttctccagtgccgtctacttcgcagaggctgacaaccag
ggaacccatttctctagcatccctgacgccttctggtgggcagtggtcaccatgaccact
gtgggctacggggacatgaggcccatcactgttgggggcaagatcgtgggctcgctgtgt
gccatcgccggggtcctcaccattgccctgcctgtgcccgtcatcgtctccaacttcaac
tacttctaccaccgggaaacggatcacgaggagccggcagtccttaaggaagagcagggc
actcagagccaggggccggggctggacagaggagtccagcggaaggtcagcgggagcagg
ggatccttctgcaaggctggggggaccctggagaatgcagacagtgcccgaaggggcagc
tgccccctagagaagtgtaacgtcaaggccaagagcaacgtggacttgcggaggtccctt
tatgccctctgcctggacaccagccgggaaacagatttgtga

DBGET integrated database retrieval system