KEGG   Homo sapiens (human): 374654Help
Entry
374654            CDS       T01001                                 

Gene name
KIF7, ACLS, AGBK, HLS2, JBTS12, UNQ340
Definition
(RefSeq) kinesin family member 7
  KO
K18806  kinesin family member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Disease
H00263  Acrocallosal syndrome
H00530  Joubert syndrome
H01265  Hydrolethalus syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    374654 (KIF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    374654 (KIF7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    374654 (KIF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    374654 (KIF7)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     374654 (KIF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd
Motif
Other DBs
NCBI-GeneID: 374654
NCBI-ProteinID: NP_940927
OMIM: 611254
HGNC: 30497
Ensembl: ENSG00000166813
Vega: OTTHUMG00000157177
Pharos: Q2M1P5(Tbio)
UniProt: Q2M1P5
LinkDB All DBs
Structure
PDB: 

Position
15q26.1
AA seq 1343 aa AA seqDB search
MGLEAQRLPGAEEAPVRVALRVRPLLPKELLHGHQSCLQVEPGLGRVTLGRDRHFGFHVV
LAEDAGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLLEDEQGIV
PRAMAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDERGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHLNHLSSRSHTVFTVTLEQRGRAPSRLPRPAP
GQLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSSLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATVNWRPE
AERPPEETASGARGPPRHRSETRIIHRGRRAPGPATASAAAAMRLGAECARYRACTDAAY
SLLRELQAEPGLPGAAARKVRDWLCAVEGERSALSSASGPDSGIESASVEDQAAQGAGGR
KEDEGAQQLLTLQNQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMVELRLRLEL
VRPGWGGPRLLNGLPPGSFVPRPHTAPLGGAHAHVLGMVPPACLPGDEVGSEQRGEQVTN
GREAGAELLTEVNRLGSGSSAASEEEEEEEEPPRRTLHLRRNRISNCSQRAGARPGSLPE
RKGPELCLEELDAAIPGSRAVGGSKARVQARQVPPATASEWRLAQAQQKIRELAINIRMK
EELIGELVRTGKAAQALNRQHSQRIRELEQEAEQVRAELSEGQRQLRELEGKELQDAGER
SRLQEFRRRVAAAQSQVQVLKEKKQATERLVSLSAQSEKRLQELERNVQLMRQQQGQLQR
RLREETEQKRRLEAEMSKRQHRVKELELKHEQQQKILKIKTEEIAAFQRKRRSGSNGSVV
SLEQQQKIEEQKKWLDQEMEKVLQQRRALEELGEELHKREAILAKKEALMQEKTGLESKR
LRSSQALNEDIVRVSSRLEHLEKELSEKSGQLRQGSAQSQQQIRGEIDSLRQEKDSLLKQ
RLEIDGKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASASLLSQC
EMNLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRLVYWLEV
ALERQRLEMDRQLTLQQKEHEQNMQLLLQQSRDHLGEGLADSRRQYEARIQALEKELGRY
MWINQELKQKLGGVNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPR
TREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGEAGLPWNFGP
LSKPRRELRRASPGMIDVRKNPL
NT seq 4032 nt NT seq  +upstreamnt  +downstreamnt
atggggctggaggctcagaggctgccaggggctgaggaggccccagtgcgggttgccctg
cgagttcgaccactgctgcccaaggagctgctgcacgggcatcagagctgcctgcaggtg
gagccagggcttggccgcgtcactctgggccgtgaccgacactttggcttccacgtggtg
ctggccgaggatgcggggcaggaggccgtgtaccaggcctgcgttcagcccctccttgag
gccttcttcgagggcttcaatgccactgtctttgcctatggtcagacgggctcagggaag
acatacaccatgggggaggccagtgtggcctccctccttgaggatgagcagggcattgtc
ccgagggccatggccgaggccttcaagctcatcgatgagaacgacctgcttgactgtctg
gtacatgtgtcctacctggaagtgtacaaggaggagttccgagacctgctcgaggtgggc
actgccagccgtgacatccagctccgggaagatgagcgcgggaatgttgtgctgtgcggg
gtgaaggaggtcgacgtggagggcctggatgaggtgctgagcctcctggagatgggcaac
gcggcgcggcacacgggagccacgcacctcaaccacctgtctagccgctcacacacggtc
ttcaccgtgaccctggagcagcgggggcgcgcccccagccgcctaccccgccccgccccg
ggccagctgctcgtctccaagttccacttcgtggacctggcgggctcagagagggtgctc
aagacgggcagcaccggcgagcggctcaaggagagcatccagatcaacagcagcctcctg
gcgctgggcaacgtcatcagcgccctgggggaccctcagcgccggggcagccacataccc
taccgcgactccaagatcacccggatcctcaaagactcgctgggcgggaacgccaagacg
gtgatgatcgcctgcgtcagcccttcctcctccgacttcgacgagaccctcaacaccctc
aactacgccagccgcgcccagaacatccgcaaccgcgccacggtcaactggcggcccgag
gccgagcggccacccgaagagacggcgagcggcgcgcggggtccgccacggcaccgctcc
gagacccgcatcatccaccgcggccggcgcgccccaggcccagccaccgcctccgcggcg
gccgccatgcgcctgggcgccgagtgcgcgcgctaccgggcctgcaccgacgccgcctac
agcctcttgcgcgagctgcaggccgagcccgggctgcccggcgccgccgcccgcaaggtg
cgcgactggctgtgcgccgtcgagggcgagcgcagcgccctgagctccgcctccgggccc
gatagcggcatcgagagcgcctccgtcgaggaccaggcggcgcagggggccggcgggcga
aaggaggatgagggggcgcagcagctgctgaccctgcagaaccaggtggcgcggctggag
gaggagaaccgagactttctggctgcgctggaggacgccatggagcagtacaaactgcag
agcgaccggctgcgtgagcagcaggaggagatggtggaactgcggctgcggttagagctg
gtgcggccaggctgggggggcccgcggctcctgaatggcctgcctcccgggtcctttgtg
cctcgacctcatacagcccccctggggggtgcccacgcccatgtgctgggcatggtgccg
cctgcctgcctccctggagatgaagttggctctgagcagaggggagagcaggtgacaaat
ggcagggaggctggagctgagttgctgactgaggtgaacaggctgggaagtggctcttca
gctgcttcagaggaggaagaggaggaggaggagccgcccaggcggaccttacacctgcgc
agaaataggatcagcaactgcagtcagagggcgggggcacgcccagggagtctgccagag
aggaagggcccagagctttgccttgaggagttggatgcagccattccagggtccagagca
gttggtgggagcaaggcccgagttcaggcccgccaggtcccccctgccacagcctcagag
tggcggctggcccaggcccagcagaagatccgggagctggctatcaacatccgcatgaag
gaggagcttattggcgagctggtccgcacaggaaaggcagctcaggccctgaaccgccag
cacagccagcgtatccgggagctggagcaggaggcagagcaggtgcgggccgagctgagt
gaaggccagaggcagctgcgggagctcgagggcaaggagctccaggatgctggcgagcgg
tctcggctccaggagttccgcaggagggtcgctgcggcccagagccaggtgcaggtgctg
aaggagaagaagcaggctacggagcggctggtgtcactgtcggcccagagtgagaagcga
ctgcaggagctcgagcggaacgtgcagctcatgcggcagcagcagggacagctgcagagg
cggcttcgcgaggagacggagcagaagcggcgcctggaggcagaaatgagcaagcggcag
caccgcgtcaaggagctggagctgaagcatgagcaacagcagaagatcctgaagattaag
acggaagagatcgcggcattccagaggaagaggcgcagtggcagcaacggctctgtggtc
agcctggaacagcagcagaagattgaggagcagaagaagtggctggaccaggagatggag
aaggtgctacagcagcggcgggcgctggaggagctgggggaggagctccacaagcgggag
gccatcctggccaagaaggaggccctgatgcaggagaagacggggctggagagcaagcgc
ctgagatccagccaggccctcaacgaggacatcgtgcgagtgtccagccggctggagcac
ctggagaaggagctgtccgagaagagcgggcagctgcggcagggcagcgcccagagccag
cagcagatccgcggggagatcgacagcctgcgccaggagaaggactcgctgctcaagcag
cgcctggagatcgacggcaagctgaggcaggggagtctgctgtcccccgaggaggagcgg
acgctgttccagttggatgaggccatcgaggccctggatgctgccattgagtataagaat
gaggccatcacatgccgccagcgggtgcttcgggcctcagcctcgttgctgtcccagtgc
gagatgaacctcatggccaagctcagctacctctcatcctcagagaccagagccctcctc
tgcaagtattttgacaaggtggtgacgctccgagaggagcagcaccagcagcagattgcc
ttctcggaactggagatgcagctggaggagcagcagaggctggtgtactggctggaggtg
gccctggagcggcagcgcctggagatggaccgccagctgaccctgcagcagaaggagcac
gagcagaacatgcagctgctcctgcagcagagtcgagaccacctcggtgaagggttagca
gacagcaggaggcagtatgaggcccggattcaagctctggagaaggaactgggccgttac
atgtggataaaccaggaactgaaacagaagctcggcggtgtgaacgctgtaggccacagc
aggggtggggagaagaggagcctgtgctcggagggcagacaggctcctggaaatgaagat
gagctccacctggcacccgagcttctctggctgtcccccctcactgagggggccccccgc
acccgggaggagacgcgggacttggtccacgctccgttacccttgacctggaaacgctcg
agcctgtgtggtgaggagcaggggtcccccgaggaactgaggcagcgggaggcggctgag
cccctggtggggcgggtgcttcctgtgggtgaggcaggcctgccctggaactttgggcct
ttgtccaagccccggcgggaactgcgacgagccagcccggggatgattgatgtccggaaa
aaccccctgtaa

DBGET integrated database retrieval system