KEGG   Homo sapiens (human): 374659Help
Entry
374659            CDS       T01001                                 

Gene name
HDDC3, (ppGpp)ase, MESH1
Definition
(RefSeq) HD domain containing 3
  KO
K21138  guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase [EC:3.1.7.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    374659 (HDDC3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.7  Diphosphoric-monoester hydrolases
    3.1.7.2  guanosine-3',5'-bis(diphosphate) 3'-diphosphatase
     374659 (HDDC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HD_4 HD
Motif
Other DBs
NCBI-GeneID: 374659
NCBI-ProteinID: NP_001273380
HGNC: 30522
Ensembl: ENSG00000184508
Vega: OTTHUMG00000141260
Pharos: Q8N4P3(Tbio)
UniProt: Q8N4P3
LinkDB All DBs
Structure
PDB: 

Position
15q26.1
AA seq 179 aa AA seqDB search
MGSEAAQLLEAADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALL
HDTVEDTDTTLDEVELHFGAQVRRLVEEVTDDKTLPKLERKRLQVEQAPHSSPGAKLVKL
ADKLYNLRDLNRCTPEGWSEHRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQRGLTI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggctctgaggcggcgcagctgctggaggctgccgacttcgcggctcgcaagcaccgg
cagcagcggcggaaggaccccgaggggaccccctacatcaaccaccccatcggtgtggca
cggatcctgacccacgaggcgggaatcactgacattgtggtgttacaggcggccctgctc
catgacacggtggaggacacagacaccaccctggatgaggtggagctacactttggggca
caagtgcggcgcctggtggaggaggtaacagatgacaagactctgcccaagctggagaga
aagaggctgcaggtggagcaagcgccccacagtagccccggggccaaactggtgaagctg
gcagacaagctgtacaatctgagggacctgaatcgctgcaccccagagggatggtcagaa
catcgagtccaggaatacttcgagtgggcagcgcaggtggtgaaggggcttcagggaaca
aaccggcaactggaagaggctctaaagcatctgttcaagcagcgggggctgacaatctga

DBGET integrated database retrieval system