KEGG   Homo sapiens (human): 375Help
Entry
375               CDS       T01001                                 

Gene name
ARF1, PVNH8
Definition
(RefSeq) ADP ribosylation factor 1
  KO
K07937  ADP-ribosylation factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05110  Vibrio cholerae infection
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    375 (ARF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    375 (ARF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    375 (ARF1)
   05134 Legionellosis
    375 (ARF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    375 (ARF1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    375 (ARF1)
   04031 GTP-binding proteins [BR:hsa04031]
    375 (ARF1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    375 (ARF1)
  Arf GTPases and associated proteins
   Arf GTPases
    375 (ARF1)
 Endosome - Golgi transport
    375 (ARF1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   375 (ARF1)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    375 (ARF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Motif
Other DBs
NCBI-GeneID: 375
NCBI-ProteinID: NP_001019397
OMIM: 103180
HGNC: 652
Ensembl: ENSG00000143761
Vega: OTTHUMG00000037595
Pharos: P84077(Tchem)
UniProt: P84077 A0A024R3Q3
LinkDB All DBs
Structure
PDB: 

Position
1q42.13
AA seq 181 aa AA seqDB search
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggggaacatcttcgccaacctcttcaagggcctttttggcaaaaaagaaatgcgcatc
ctcatggtgggcctggatgctgcagggaagaccacgatcctctacaagcttaagctgggt
gagatcgtgaccaccattcccaccataggcttcaacgtggaaaccgtggagtacaagaac
atcagcttcactgtgtgggacgtgggtggccaggacaagatccggcccctgtggcgccac
tacttccagaacacacaaggcctgatcttcgtggtggacagcaatgacagagagcgtgtg
aacgaggcccgtgaggagctcatgaggatgctggccgaggacgagctccgggatgctgtc
ctcctggtgttcgccaacaagcaggacctccccaacgccatgaatgcggccgagatcaca
gacaagctggggctgcactcactacgccacaggaactggtacattcaggccacctgcgcc
accagcggcgacgggctctatgaaggactggactggctgtccaatcagctccggaaccag
aagtga

KEGG   Homo sapiens (human): 377Help
Entry
377               CDS       T01001                                 

Gene name
ARF3
Definition
(RefSeq) ADP ribosylation factor 3
  KO
K07938  ADP-ribosylation factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    377 (ARF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    377 (ARF3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    377 (ARF3)
   04031 GTP-binding proteins [BR:hsa04031]
    377 (ARF3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    377 (ARF3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   377 (ARF3)
  Exosomal proteins of colorectal cancer cells
   377 (ARF3)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    377 (ARF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Motif
Other DBs
NCBI-GeneID: 377
NCBI-ProteinID: NP_001650
OMIM: 103190
HGNC: 654
Ensembl: ENSG00000134287
Vega: OTTHUMG00000168080
Pharos: P61204(Tbio)
UniProt: P61204 A0A024R0Y6
LinkDB All DBs
Position
12q13.12
AA seq 181 aa AA seqDB search
MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatatctttggaaaccttctcaagagcctgattgggaagaaggagatgcgcatc
ctgatggtgggcctggatgccgcaggaaagaccaccatcctatacaagctgaaactcggg
gagatcgtcaccaccatccctaccattgggttcaatgtggagacagtggagtataagaac
atcagctttacagtgtgggatgtgggtggccaggacaagattcgacccctctggagacac
tacttccagaacacccaagggttgatatttgtggtcgacagcaatgatcgggagcgagta
aatgaggcccgggaagagctgatgagaatgctggcggaggacgagctccgggatgctgta
ctccttgtctttgcaaacaaacaggatctgcctaatgctatgaacgctgctgagatcaca
gacaagctgggcctgcattcccttcgtcaccgtaactggtacattcaggccacctgtgcc
accagcggggacgggctgtacgaaggcctggactggctggccaatcagctcaaaaacaag
aagtga

KEGG   Homo sapiens (human): 381Help
Entry
381               CDS       T01001                                 

Gene name
ARF5
Definition
(RefSeq) ADP ribosylation factor 5
  KO
K07940  ADP-ribosylation factor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    381 (ARF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    381 (ARF5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    381 (ARF5)
   04031 GTP-binding proteins [BR:hsa04031]
    381 (ARF5)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    381 (ARF5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   381 (ARF5)
  Exosomal proteins of colorectal cancer cells
   381 (ARF5)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    381 (ARF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K CbiA
Motif
Other DBs
NCBI-GeneID: 381
NCBI-ProteinID: NP_001653
OMIM: 103188
HGNC: 658
Ensembl: ENSG00000004059
Vega: OTTHUMG00000023246
Pharos: P84085(Tbio)
UniProt: P84085 A4D0Z3
LinkDB All DBs
Structure
PDB: 

Position
7q32.1
AA seq 180 aa AA seqDB search
MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAV
LLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcaccgtgtccgcgctcttttcgcggatcttcgggaagaagcagatgcggatt
ctcatggttggcttggatgcggctggcaagaccacaatcctgtacaaactgaagttgggg
gagattgtcaccaccatcccaaccataggcttcaatgtagaaacagtggaatataagaac
atctgtttcacagtctgggacgtgggaggccaggacaagattcggcctctgtggcggcac
tacttccagaacactcagggcctcatctttgtggtggacagtaatgaccgggagcgggtc
caagaatctgctgatgaactccagaagatgctgcaggaggacgagctgcgggatgcagtg
ctgctggtatttgccaacaagcaggacatgcccaacgccatgcccgtgagcgagctgact
gacaagctggggctacagcacttacgcagccgcacgtggtatgtccaggccacctgtgcc
acccaaggcacaggtctgtacgatggtctggactggctgtcccacgagctgtcaaagcgc
taa

KEGG   Homo sapiens (human): 382Help
Entry
382               CDS       T01001                                 

Gene name
ARF6
Definition
(RefSeq) ADP ribosylation factor 6
  KO
K07941  ADP-ribosylation factor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    382 (ARF6)
   04072 Phospholipase D signaling pathway
    382 (ARF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    382 (ARF6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    382 (ARF6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    382 (ARF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    382 (ARF6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    382 (ARF6)
   04031 GTP-binding proteins [BR:hsa04031]
    382 (ARF6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    382 (ARF6)
  Arf GTPases and associated proteins
   Arf GTPases
    382 (ARF6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   382 (ARF6)
  Exosomal proteins of colorectal cancer cells
   382 (ARF6)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    382 (ARF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Roc Ras SRPRB G-alpha Gtr1_RagA MMR_HSR1 6PF2K SpoOE-like CRISPR_Cas2
Motif
Other DBs
NCBI-GeneID: 382
NCBI-ProteinID: NP_001654
OMIM: 600464
HGNC: 659
Ensembl: ENSG00000165527
Vega: OTTHUMG00000140296
Pharos: P62330(Tbio)
UniProt: P62330
LinkDB All DBs
Structure
PDB: 

Position
14q21.3
AA seq 175 aa AA seqDB search
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtgctatccaaaatcttcgggaacaaggaaatgcggatcctcatgttgggc
ctggacgcggccggcaagacaacaatcctgtacaagttgaagctgggccagtcggtgacc
accattcccactgtgggtttcaacgtggagacggtgacttacaaaaatgtcaagttcaac
gtatgggatgtgggcggccaggacaagatccggccgctctggcggcattactacactggg
acccaaggtctcatcttcgtagtggactgcgccgaccgcgaccgcatcgatgaggctcgc
caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc
gccaacaagcaggacctgcccgatgccatgaaaccccacgagatccaggagaaactgggc
ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctcaggggac
ggactctatgaggggctcacatggttaacctctaactacaaatcttaa

DBGET integrated database retrieval system