KEGG   Homo sapiens (human): 3758
Entry
3758              CDS       T01001                                 

Gene name
KCNJ1, KIR1.1, ROMK, ROMK1
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 1
  KO
K04995  potassium inwardly-rectifying channel subfamily J member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04971  Gastric acid secretion
Disease
H00239  Bartter syndrome
Drug target
Betanidine: D01603
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    3758 (KCNJ1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3758 (KCNJ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3758 (KCNJ1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3758 (KCNJ1)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 3758
NCBI-ProteinID: NP_000211
OMIM: 600359
HGNC: 6255
Ensembl: ENSG00000151704
Vega: OTTHUMG00000048247
Pharos: P48048(Tchem)
UniProt: P48048 A8K432
LinkDB
Position
11q24.3
AA seq 391 aa
MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaatgcttccagtcggaatgtgtttgacacgttgatcagggtgttgacagaaagtatg
ttcaaacatcttcggaaatgggtcgtcactcgcttttttgggcattctcggcaaagagca
aggctagtctccaaagatggaaggtgcaacatagaatttggcaatgtggaggcacagtca
aggtttatattctttgtggacatctggacaacggtacttgacctcaagtggagatacaaa
atgaccattttcatcacagccttcttggggagttggtttttctttggtctcctgtggtat
gcagtagcgtacattcacaaagacctcccggaattccatccttctgccaatcacactccc
tgtgtggagaatattaatggcttgacctcagcttttctgttttctctggagactcaagtg
accattggatatggattcaggtgtgtgacagaacagtgtgccactgccatttttctgctt
atctttcagtctatacttggagttataatcaattctttcatgtgtggggccatcttagcc
aagatctccaggcccaaaaaacgtgccaagaccattacgttcagcaagaacgcagtgatc
agcaaacggggagggaagctttgcctcctaatccgagtggctaatctcaggaagagcctt
cttattggcagtcacatttatggaaagcttctgaagaccacagtcactcctgaaggagag
accattattttggaccagatcaatatcaactttgtagttgacgctgggaatgaaaattta
ttcttcatctccccattgacaatttaccatgtcattgatcacaacagccctttcttccac
atggcagcggagacccttctccagcaggactttgaattagtggtgtttttagatggcaca
gtggagtccaccagtgctacctgccaagtccggacatcctatgtcccagaggaggtgctt
tggggctaccgttttgctcccatagtatccaagacaaaggaagggaaataccgagtggat
ttccataactttagcaagacagtggaagtggagacccctcactgtgccatgtgcctttat
aatgagaaagatgttagagccaggatgaagagaggctatgacaaccccaacttcatcttg
tcagaagtcaatgaaacagatgacaccaaaatgtaa

KEGG   Homo sapiens (human): 3759
Entry
3759              CDS       T01001                                 

Gene name
KCNJ2, ATFB9, HHBIRK1, HHIRK1, IRK1, KIR2.1, LQT7, SQT3
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 2
  KO
K04996  potassium inwardly-rectifying channel subfamily J member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
hsa04924  Renin secretion
hsa04971  Gastric acid secretion
Disease
H00215  Periodic paralysis
H00720  Long QT syndrome
H00725  Short QT syndrome
H00731  Atrial fibrillation
H00748  Andersen-Tawil syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    3759 (KCNJ2)
   04924 Renin secretion
    3759 (KCNJ2)
  09154 Digestive system
   04971 Gastric acid secretion
    3759 (KCNJ2)
  09156 Nervous system
   04725 Cholinergic synapse
    3759 (KCNJ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3759 (KCNJ2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3759 (KCNJ2)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 3759
NCBI-ProteinID: NP_000882
OMIM: 600681
HGNC: 6263
Ensembl: ENSG00000123700
Vega: OTTHUMG00000180351
Pharos: P63252(Tbio)
UniProt: P63252
LinkDB
Position
17q24.3
AA seq 427 aa
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggcagtgtgcgaaccaaccgctacagcatcgtctcttcagaagaagacggtatgaag
ttggccaccatggcagttgcaaatggctttgggaacgggaagagtaaagtccacacccga
caacagtgcaggagccgctttgtgaagaaagatggccactgtaatgttcagttcatcaat
gtgggtgagaaggggcaacggtacctcgcagacatcttcaccacgtgtgtggacattcgc
tggcggtggatgctggttatcttctgcctggctttcgtcctgtcatggctgttttttggc
tgtgtgttttggttgatagctctgctccatggggacctggatgcatccaaagagggcaaa
gcttgtgtgtccgaggtcaacagcttcacggctgccttcctcttctccattgagacccag
acaaccataggctatggtttcagatgtgtcacggatgaatgcccaattgctgttttcatg
gtggtgttccagtcaatcgtgggctgcatcatcgatgctttcatcattggcgcagtcatg
gccaagatggcaaagccaaagaagagaaacgagactcttgtcttcagtcacaatgccgtg
attgccatgagagacggcaagctgtgtttgatgtggcgagtgggcaatcttcggaaaagc
cacttggtggaagctcatgttcgagcacagctcctcaaatccagaattacttctgaaggg
gagtatatccctctggatcaaatagacatcaatgttgggtttgacagtggaatcgatcgt
atatttctggtgtccccaatcactatagtccatgaaatagatgaagacagtcctttatat
gatttgagtaaacaggacattgacaacgcagactttgaaatcgtggtcatactggaaggc
atggtggaagccactgccatgacgacacagtgccgtagctcttatctagcaaatgaaatc
ctgtggggccaccgctatgagcctgtgctctttgaagagaagcactactacaaagtggac
tattccaggttccacaaaacttacgaagtccccaacactcccctttgtagtgccagagac
ttagcagaaaagaaatatatcctctcaaatgcaaattcattttgctatgaaaatgaagtt
gccctcacaagcaaagaggaagacgacagtgaaaatggagttccagaaagcactagtacg
gacacgccccctgacatagaccttcacaaccaggcaagtgtacctctagagcccaggccc
ttacggcgagagtcggagatatga

KEGG   Homo sapiens (human): 3766
Entry
3766              CDS       T01001                                 

Gene name
KCNJ10, BIRK-10, KCNJ13-PEN, KIR1.2, KIR4.1, SESAME
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 10
  KO
K05003  potassium inwardly-rectifying channel subfamily J member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
hsa05016  Huntington disease
Disease
H00803  Seizures-sensorineural deafness-ataxia-mental retardation-electrolyte imbalance (SESAME)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    3766 (KCNJ10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    3766 (KCNJ10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3766 (KCNJ10)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3766 (KCNJ10)
SSDB
Motif
Pfam: IRK_C IRK DUF2182 Ion_trans_2
Other DBs
NCBI-GeneID: 3766
NCBI-ProteinID: NP_002232
OMIM: 602208
HGNC: 6256
Ensembl: ENSG00000177807
Vega: OTTHUMG00000024073
Pharos: P78508(Tbio)
UniProt: P78508
LinkDB
Position
1q23.2
AA seq 379 aa
MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEES
LREQAEKEGSALSVRISNV
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgacgtcagttgccaaggtgtattacagtcagaccactcagacagaaagccggccccta
atgggcccagggatacgacggcggagagtcctgacaaaagatggtcgcagcaacgtgaga
atggagcacattgccgacaagcgcttcctctacctcaaggacctgtggacaaccttcatt
gacatgcagtggcgctacaagcttctgctcttctctgcgacctttgcaggcacatggttc
ctctttggcgtggtgtggtatctggtagctgtggcacatggggacctgctggagctggac
cccccggccaaccacaccccctgtgtggtacaggtgcacacactcactggagccttcctc
ttctcccttgaatcccaaaccaccattggctatggcttccgctacatcagtgaggaatgt
ccactggccattgtgcttcttattgcccagctggtgctcaccaccatcctggaaatcttc
atcacaggtaccttcctggcgaagattgcccggcccaagaagcgggctgagaccattcgt
ttcagccagcatgcagttgtggcctcccacaatggcaagccctgcctcatgatccgagtt
gccaatatgcgcaaaagcctcctcattggctgccaggtgacaggaaaactgcttcagacc
caccaaaccaaggaaggggagaacatccggctcaaccaggtcaatgtgactttccaagta
gacacagcctctgacagccccttccttattctaccccttaccttctatcatgtggtagat
gagaccagtcccttgaaagatctccctcttcgcagtggtgagggtgactttgagctggtg
ctgatcctaagtgggacagtggagtccaccagtgccacctgtcaggtgcgcacttcctac
ctgccagaggagatcctttggggctacgagttcacacctgccatctcactgtcagccagt
ggtaaatacatagctgactttagcctttttgaccaagttgtgaaagtggcctctcctagt
ggcctccgtgacagcactgtacgctacggagaccctgaaaagctcaagttggaggagtca
ttaagggagcaagctgagaaggagggcagtgcccttagtgtgcgcatcagcaatgtctga

KEGG   Homo sapiens (human): 3772
Entry
3772              CDS       T01001                                 

Gene name
KCNJ15, IRKK, KIR1.3, KIR4.2
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 15
  KO
K05008  potassium inwardly-rectifying channel subfamily J member 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    3772 (KCNJ15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3772 (KCNJ15)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3772 (KCNJ15)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2 DUF2182
Other DBs
NCBI-GeneID: 3772
NCBI-ProteinID: NP_001263364
OMIM: 602106
HGNC: 6261
Ensembl: ENSG00000157551
Vega: OTTHUMG00000090609
Pharos: Q99712(Tbio)
UniProt: Q99712
LinkDB
Position
21q22.13-q22.2
AA seq 375 aa
MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ
RERELRTLLLQQSNV
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgccattcacatcggcatgtccagcacccccctggtgaagcacactgctggggct
gggctcaaggccaacagaccccgcgtcatgtccaagagtgggcacagcaacgtgagaatt
gacaaagtggatggcatatacctactctacctgcaagacctgtggaccacagttatcgac
atgaagtggagatacaaactcaccctgttcgctgccacttttgtgatgacctggttcctt
tttggagtcatctactatgccatcgcgtttattcatggggacttagaacccggtgagccc
atttcaaatcataccccctgcatcatgaaagtggactctctcactggggcgtttctcttt
tccctggaatcccagacaaccattggctatggagtccgttccatcacagaggaatgtcct
catgccatcttcctgttggttgctcagttggtcatcacgaccttgattgagatcttcatc
accggaaccttcctggccaaaatcgccagacccaaaaagcgggctgagaccatcaagttc
agccactgtgcagtcatcaccaagcagaatgggaagctgtgcttggtgattcaggtagcc
aatatgaggaagagcctcttgattcagtgccagctctctggcaagctcctgcagacccac
gtcaccaaggagggggagcggattctcctcaaccaagccactgtcaaattccacgtggac
tcctcctctgagagccccttcctcattctgcccatgacattctaccatgtgctggatgag
acgagccccctgagagacctcacaccccaaaacctaaaggagaaggagtttgagcttgtg
gtcctcctcaatgccactgtggaatccaccagcgctgtctgccagagccgaacatcttat
atcccagaggaaatctactggggttttgagtttgtgcctgtggtatctctctccaaaaat
ggaaaatatgtggctgatttcagtcagtttgaacagattcggaaaagcccagattgcaca
ttttactgtgcagattctgagaaacagcaactcgaggagaagtacaggcaggaggatcag
agggaaagagaactgaggacacttttattacaacagagcaatgtctga

KEGG   Homo sapiens (human): 3773
Entry
3773              CDS       T01001                                 

Gene name
KCNJ16, BIR9, KIR5.1
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 16
  KO
K05009  potassium inwardly-rectifying channel subfamily J member 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    3773 (KCNJ16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3773 (KCNJ16)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3773 (KCNJ16)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 3773
NCBI-ProteinID: NP_001257351
OMIM: 605722
HGNC: 6262
Ensembl: ENSG00000153822
Vega: OTTHUMG00000180349
Pharos: Q9NPI9(Tbio)
UniProt: Q9NPI9
LinkDB
Position
17q24.3
AA seq 418 aa
MSYYGSSYHIINADAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTG
AFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVR
ESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgagctattacggcagcagctatcatattatcaatgcggacgcaaaatacccaggctac
ccgccagagcacattatagctgagaagagaagagcaagaagacgattacttcacaaagat
ggcagctgtaatgtctacttcaagcacatttttggagaatggggaagctatgtggttgac
atcttcaccactcttgtggacaccaagtggcgccatatgtttgtgatattttctttatct
tatattctctcgtggttgatatttggctctgtcttttggctcatagcctttcatcatggc
gatctattaaatgatccagacatcacaccttgtgttgacaacgtccattctttcacaggg
gcctttttgttctccctagagacccaaaccaccataggatatggttatcgctgtgttact
gaagaatgttctgtggccgtgctcatggtgatcctccagtccatcttaagttgcatcata
aatacctttatcattggagctgccttggccaaaatggcaactgctcgaaagagagcccaa
accattcgtttcagctactttgcacttataggtatgagagatgggaagctttgcctcatg
tggcgcattggtgattttcggccaaaccacgtggtagaaggaacagttagagcccaactt
ctccgctatacagaagacagtgaagggaggatgacgatggcatttaaagacctcaaatta
gtcaacgaccaaatcatcctggtcaccccggtaactattgtccatgaaattgaccatgag
agccctctgtatgcccttgaccgcaaagcagtagccaaagataactttgagattttggtg
acatttatctatactggtgattccactggaacatctcaccaatctagaagctcctatgtt
ccccgagaaattctctggggccataggtttaatgatgtcttggaagttaagaggaagtat
tacaaagtgaactgcttacagtttgaaggaagtgtggaagtatatgcccccttttgcagt
gccaagcaattggactggaaagaccagcagctccacatagaaaaagcaccaccagttcga
gaatcctgcacgtcggacaccaaggcgagacgaaggtcatttagtgcagttgccattgtc
agcagctgtgaaaaccctgaggagaccaccacttccgccacacatgaatatagggaaaca
ccttatcagaaagctctcctgactttaaacagaatctctgtagaatcccaaatgtag

DBGET integrated database retrieval system