KEGG   Homo sapiens (human): 3762Help
Entry
3762              CDS       T01001                                 

Gene name
KCNJ5, CIR, GIRK4, KATP1, KIR3.4, LQT13
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 5
  KO
K04999  potassium inwardly-rectifying channel subfamily J member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04929  GnRH secretion
hsa05032  Morphine addiction
Network
nt06316  Angiotensin-aldosterone signaling
  Element
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
Disease
H00720  Long QT syndrome
H01603  Primary aldosteronism
Drug target
Amiodarone (DG00204): D00636 D02910
Bepridil (DG00333): D00631 D07520
Dronedarone (DG00207): D02537 D03914
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    3762 (KCNJ5)
   04915 Estrogen signaling pathway
    3762 (KCNJ5)
   04921 Oxytocin signaling pathway
    3762 (KCNJ5)
   04925 Aldosterone synthesis and secretion
    3762 (KCNJ5)
  09156 Nervous system
   04728 Dopaminergic synapse
    3762 (KCNJ5)
   04726 Serotonergic synapse
    3762 (KCNJ5)
   04723 Retrograde endocannabinoid signaling
    3762 (KCNJ5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    3762 (KCNJ5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    3762 (KCNJ5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3762 (KCNJ5)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3762 (KCNJ5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 3762
NCBI-ProteinID: NP_000881
OMIM: 600734
HGNC: 6266
Ensembl: ENSG00000120457
Vega: OTTHUMG00000165795
Pharos: P48544(Tbio)
UniProt: P48544
LinkDB All DBs
Position
11q24.3
AA seq 419 aa AA seqDB search
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgattctaggaatgccatgaaccaggacatggagattggagtcactccctgg
gaccccaagaagattccaaaacaggcccgcgattatgtccccattgccacagaccgtacg
cgcctgctggccgagggcaagaagccacgccagcgctacatggagaagagtggcaagtgc
aacgtgcaccacggcaacgtccaggagacctaccggtacctgagtgacctcttcaccacc
ctggtggacctcaagtggcgcttcaacttgctcgtcttcaccatggtttacactgtcacc
tggctgttcttcggcttcatttggtggctcattgcttatatccggggtgacctggaccat
gttggcgaccaagagtggattccttgtgttgaaaacctcagtggcttcgtgtccgctttc
ctgttctccattgagaccgaaacaaccattgggtatggcttccgagtcatcacagagaag
tgtccagaggggattatactcctcttggtccaggccatcctgggctccatcgtcaatgcc
ttcatggtggggtgcatgtttgtcaagatcagccagcccaagaagagagcggagaccctc
atgttttccaacaacgcagtcatctccatgcgggacgagaagctgtgcctcatgttccgg
gtgggcgacctccgcaactcccacatcgtggaggcctccatccgggccaagctcatcaag
tcccggcagaccaaagagggggagttcatccccctgaaccagacagacatcaacgtgggc
tttgacacgggcgacgaccgcctcttccttgtgtctcctctgatcatctcccatgagatc
aaccagaagagccctttctgggagatgtctcaggctcagctgcatcaggaagagtttgaa
gttgtggtcattctagaagggatggtggaagccacaggcatgacctgccaagcccggagc
tcctacatggatacagaggtgctctggggccaccgattcacaccagtcctcaccttggaa
aagggcttctatgaggtggactacaacaccttccatgatacctatgagaccaacacaccc
agctgctgtgccaaggagctggcagaaatgaagagggaaggccggctcctccagtacctc
cccagccccccactgctggggggctgtgctgaggcagggctggatgcagaggctgagcag
aatgaagaagatgagcccaaggggctgggtgggtccagggaggccaggggctcggtgtga

DBGET integrated database retrieval system