KEGG   Homo sapiens (human): 3766
Entry
3766              CDS       T01001                                 

Gene name
KCNJ10, BIRK-10, KCNJ13-PEN, KIR1.2, KIR4.1, SESAME
Definition
(RefSeq) potassium inwardly rectifying channel subfamily J member 10
  KO
K05003  potassium inwardly-rectifying channel subfamily J member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
hsa05016  Huntington disease
Disease
H00803  Seizures-sensorineural deafness-ataxia-mental retardation-electrolyte imbalance (SESAME)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    3766 (KCNJ10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    3766 (KCNJ10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3766 (KCNJ10)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3766 (KCNJ10)
SSDB
Motif
Pfam: IRK_C IRK DUF2182 Ion_trans_2
Other DBs
NCBI-GeneID: 3766
NCBI-ProteinID: NP_002232
OMIM: 602208
HGNC: 6256
Ensembl: ENSG00000177807
Vega: OTTHUMG00000024073
Pharos: P78508(Tbio)
UniProt: P78508
LinkDB
Position
1q23.2
AA seq 379 aa
MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEES
LREQAEKEGSALSVRISNV
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgacgtcagttgccaaggtgtattacagtcagaccactcagacagaaagccggccccta
atgggcccagggatacgacggcggagagtcctgacaaaagatggtcgcagcaacgtgaga
atggagcacattgccgacaagcgcttcctctacctcaaggacctgtggacaaccttcatt
gacatgcagtggcgctacaagcttctgctcttctctgcgacctttgcaggcacatggttc
ctctttggcgtggtgtggtatctggtagctgtggcacatggggacctgctggagctggac
cccccggccaaccacaccccctgtgtggtacaggtgcacacactcactggagccttcctc
ttctcccttgaatcccaaaccaccattggctatggcttccgctacatcagtgaggaatgt
ccactggccattgtgcttcttattgcccagctggtgctcaccaccatcctggaaatcttc
atcacaggtaccttcctggcgaagattgcccggcccaagaagcgggctgagaccattcgt
ttcagccagcatgcagttgtggcctcccacaatggcaagccctgcctcatgatccgagtt
gccaatatgcgcaaaagcctcctcattggctgccaggtgacaggaaaactgcttcagacc
caccaaaccaaggaaggggagaacatccggctcaaccaggtcaatgtgactttccaagta
gacacagcctctgacagccccttccttattctaccccttaccttctatcatgtggtagat
gagaccagtcccttgaaagatctccctcttcgcagtggtgagggtgactttgagctggtg
ctgatcctaagtgggacagtggagtccaccagtgccacctgtcaggtgcgcacttcctac
ctgccagaggagatcctttggggctacgagttcacacctgccatctcactgtcagccagt
ggtaaatacatagctgactttagcctttttgaccaagttgtgaaagtggcctctcctagt
ggcctccgtgacagcactgtacgctacggagaccctgaaaagctcaagttggaggagtca
ttaagggagcaagctgagaaggagggcagtgcccttagtgtgcgcatcagcaatgtctga

DBGET integrated database retrieval system