KEGG   Homo sapiens (human): 3780
Entry
3780              CDS       T01001                                 

Gene name
KCNN1, KCa2.1, SK1, SKCA1, hSK1
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 1
  KO
K04942  potassium intermediate/small conductance calcium-activated channel subfamily N member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
hsa04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3780 (KCNN1)
   04929 GnRH secretion
    3780 (KCNN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3780 (KCNN1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   3780 (KCNN1)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 Seryl_tRNA_N DALR_1 Laminin_II IRK
Other DBs
NCBI-GeneID: 3780
NCBI-ProteinID: NP_002239
OMIM: 602982
HGNC: 6290
Ensembl: ENSG00000105642
Vega: OTTHUMG00000183482
Pharos: Q92952(Tchem)
UniProt: Q92952
LinkDB
Position
19p13.11
AA seq 543 aa
MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPR
GQPQDQDDDEDDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVV
MVTETELSWGVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIA
MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEA
RLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPS
DCG
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgaacagccacagctacaatggcagcgtggggcggccgctgggcagcgggccgggcgcc
ctgggacgagaccctccggaccctgaggccggccaccccccacaacccccgcacagcccg
ggcctccaggtggtagtggccaagagtgagccagcccggccctcacccggcagcccccgg
gggcagccccaggaccaggacgatgacgaggatgatgaggaagatgaggccggcaggcag
agagcctcggggaaaccctcaaatgtgggccaccgcctgggccaccggcgggcgctcttc
gagaagcggaagcgcctcagcgactatgccctcattttcggcatgtttggcatcgtcgtc
atggtgacggagaccgagctgtcctggggggtgtacaccaaggagtctctgtactcattc
gcactcaaatgcctcatcagcctctccacggccatcctgctgggtctcgttgtcctctac
catgcccgggagatccagctgttcatggtggacaacggggctgatgactggcgcatcgcc
atgacctgcgagcgcgtgttcctcatctcgctagagctggcagtgtgcgccattcacccg
gtgcccggccactaccgcttcacgtggacggcgcggctggccttcacgtacgcgccctcg
gtggccgaggccgacgtggacgtgctgctgtccatccccatgttcctgcgcctctacctg
ctgggccgggtgatgctactgcacagcaaaatcttcacggacgcctcgagccgcagcatc
ggggccctcaacaagatcaccttcaacacgcgcttcgtcatgaagacactcatgaccatc
tgccccggcaccgtgctgctggtcttcagcatctcctcctggatcatcgcagcctggacc
gtgcgcgtctgcgagaggtaccacgacaagcaggaagtgaccagcaacttcctgggggcc
atgtggctgatttccatcaccttcctctccattggctacggcgacatggtgccccacacc
tactgcgggaagggtgtgtgcctgctcactggcatcatgggagctggctgtaccgcgctc
gtggtggctgtggtggctcggaagctggagctcaccaaggctgagaagcacgtgcacaac
ttcatgatggacactcagctcaccaagcgggtaaaaaacgccgctgctaacgttctcagg
gagacgtggctcatctacaaacataccaggctggtgaagaagccagaccaagcccgggtt
cggaaacaccagcgtaagttcctccaagccatccatcaggctcagaagctccggagtgtg
aagatcgagcaagggaagctgaacgaccaggctaacacgcttaccgacctagccaagacc
cagaccgtcatgtacgaccttgtatcggagctgcacgctcagcacgaggagctggaggcc
cgcctggccaccctggaaagccgcttggatgcgctgggtgcctctctacaggccctgcct
ggcctcatcgcccaagccatacgcccacccccgcctcccctgcctcccaggcccggcccc
ggcccccaagaccaggcagcccggagctccccctgccggtggacgcccgtggccccctcg
gactgcgggtga

KEGG   Homo sapiens (human): 3781
Entry
3781              CDS       T01001                                 

Gene name
KCNN2, KCa2.2, SK2, SKCA2, SKCa_2, hSK2
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 2
  KO
K04943  potassium intermediate/small conductance calcium-activated channel subfamily N member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04911  Insulin secretion
hsa04929  GnRH secretion
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3781 (KCNN2)
   04929 GnRH secretion
    3781 (KCNN2)
  09154 Digestive system
   04976 Bile secretion
    3781 (KCNN2)
  09156 Nervous system
   04726 Serotonergic synapse
    3781 (KCNN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3781 (KCNN2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   3781 (KCNN2)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 Med9 YvrJ IRK
Other DBs
NCBI-GeneID: 3781
NCBI-ProteinID: NP_067627
OMIM: 605879
HGNC: 6291
Ensembl: ENSG00000080709
Vega: OTTHUMG00000128836
Pharos: Q9H2S1(Tchem)
UniProt: Q9H2S1
LinkDB
Structure
PDB: 
5V03 5V02 5WBX 5WC5 6ALE

Position
5q22.3
AA seq 791 aa
METPLQFQRGFFPEQPPPPPRSSHLHCQQQQQSQDKPCPPFAPLPHPHHHPHLAHQQPAS
GGSSPCLRCNSCASSGAPAAGAGDNLSLLLRTSSPGGAFRTRTSSPLSGSSCCCCCCSSR
RGSQLNVSELTPSSHASALRQQYAQQSAQQSASASQYHQCHSLQPAASPTGSLGSLGSGP
PLSHHHHHPHPAHHQHHQPQARRESNPFTEIAMSSCRYNGGVMRPLSNLSASRRNLHEMD
SEAQPLQPPASVGGGGGASSPSAAAAAAAAVSSSAPEIVVSKPEHNNSNNLALYGTGGGG
STGGGGGGGGSGHGSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVV
MVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIA
MTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYL
IARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWT
VRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKV
RKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIV
TLETKLETLIGSIHALPGLISQTIRQQQRDFIEAQMESYDKHVTYNAERSRSSSRRRRSS
STAPPTSSESS
NT seq 2376 nt   +upstreamnt  +downstreamnt
atggaaaccccattgcagttccagcgcggcttcttcccagagcagccgccgccgccgccg
cgctcctcacacctgcattgccagcagcagcaacagagccaggacaagccgtgcccgccc
ttcgcgcccctcccgcaccctcaccaccacccgcacctcgcgcaccagcagccggccagc
ggcggcagcagcccatgcctccggtgcaacagctgcgcctcctccggtgccccggcggcg
ggggcgggagataacctgtccctgctgctccgcacctcctcgcccggcggcgccttccgg
acccgcacctcctcgccgctgtcgggctcgtcctgctgctgctgctgctgctcgtcgcgc
cggggcagccagctcaatgtgagcgagctgacgccgtccagccatgccagtgcgctccgg
cagcagtacgcgcagcagtccgcgcagcagtcggcgtccgcctcccagtaccaccagtgc
cacagcctgcagcccgccgccagccccacgggcagcctcggcagtctgggctccgggccc
ccgctctcgcaccaccaccaccacccgcacccggcgcaccaccagcaccaccagccccag
gcgcgccgcgagagcaaccccttcaccgaaatagccatgagcagctgcaggtacaacggg
ggcgtcatgcggccgctcagcaacttgagcgcgtcccgccggaacctgcacgagatggac
tcagaggcgcagcccctgcagccccccgcgtctgtcggaggaggtggcggcgcgtcctcc
ccgtctgcagccgctgccgccgccgccgctgtttcgtcctcagcccccgagatcgtggtg
tctaagcccgagcacaacaactccaacaacctggcgctctatggaaccggcggcggaggc
agcactggaggaggcggcggcggtggcgggagcgggcacggcagcagcagtggcaccaag
tccagcaaaaagaaaaaccagaacatcggctacaagctgggccaccggcgcgccctgttc
gaaaagcgcaagcggctcagcgactacgcgctcatcttcggcatgttcggcatcgtggtc
atggtcatcgagaccgagctgtcgtggggcgcctacgacaaggcgtcgctgtattcctta
gctctgaaatgccttatcagtctctccacgatcatcctgctcggtctgatcatcgtgtac
cacgccagggaaatacagttgttcatggtggacaatggagcagatgactggagaatagcc
atgacttatgagcgtattttcttcatctgcttggaaatactggtgtgtgctattcatccc
atacctgggaattatacattcacatggacggcccggcttgccttctcctatgccccatcc
acaaccaccgctgatgtggatattattttatctataccaatgttcttaagactctatctg
attgccagagtcatgcttttacatagcaaacttttcactgatgcctcctctagaagcatt
ggagcacttaataagataaacttcaatacacgttttgttatgaagactttaatgactata
tgcccaggaactgtactcttggtttttagtatctcattatggataattgccgcatggact
gtccgagcttgtgaaaggtaccatgatcaacaggatgttactagcaacttccttggagcg
atgtggttgatatcaataacttttctctccattggttatggtgacatggtacctaacaca
tactgtggaaaaggagtctgcttacttactggaattatgggtgctggttgcacagccctg
gtggtagctgtagtggcaaggaagctagaacttaccaaagcagaaaaacacgtgcacaat
ttcatgatggatactcagctgactaaaagagtaaaaaatgcagctgccaatgtactcagg
gaaacatggctaatttacaaaaatacaaagctagtgaaaaagatagatcatgcaaaagta
agaaaacatcaacgaaaattcctgcaagctattcatcaattaagaagtgtaaaaatggag
cagaggaaactgaatgaccaagcaaacactttggtggacttggcaaagacccagaacatc
atgtatgatatgatttctgacttaaacgaaaggagtgaagacttcgagaagaggattgtt
accctggaaacaaaactagagactttgattggtagcatccacgccctccctgggctcata
agccagaccatcaggcagcagcagagagatttcattgaggctcagatggagagctacgac
aagcacgtcacttacaatgctgagcggtcccggtcctcgtccaggaggcggcggtcctct
tccacagcaccaccaacttcatcagagagtagctag

KEGG   Homo sapiens (human): 3782
Entry
3782              CDS       T01001                                 

Gene name
KCNN3, KCa2.3, SK3, SKCA3, ZLS3, hSK3
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 3
  KO
K04944  potassium intermediate/small conductance calcium-activated channel subfamily N member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
hsa04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3782 (KCNN3)
   04929 GnRH secretion
    3782 (KCNN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3782 (KCNN3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   3782 (KCNN3)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 IRK
Other DBs
NCBI-GeneID: 3782
NCBI-ProteinID: NP_002240
OMIM: 602983
HGNC: 6292
Ensembl: ENSG00000143603
Vega: OTTHUMG00000037260
Pharos: Q9UGI6(Tchem)
UniProt: Q9UGI6
LinkDB
Position
1q21.3
AA seq 731 aa
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQ
PQPPQLQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAIL
HPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKY
SGGVMKPLSRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNAT
HNHQHAGTTASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVI
ETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTY
ERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIAR
VMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRV
CERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVA
VVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKH
QRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLE
SKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTS
FPTPYTSSSSC
NT seq 2196 nt   +upstreamnt  +downstreamnt
atggacacttctgggcacttccatgactcgggggtgggggacttggatgaagaccccaag
tgcccctgtccatcctctggggatgagcagcagcagcagcagcagcagcaacagcagcag
cagccaccaccgccagcgccaccagcagccccccagcagcccctgggaccctcgctgcag
cctcagcctccgcagcttcagcagcagcagcagcagcagcagcagcagcagcagcagcag
ccaccgcatcccctgtctcagctcgcccaactccagagccagcccgtccaccctggcctg
ctgcactcctctcccaccgctttcagggcccccccttcgtccaactccaccgccatcctc
cacccttcctccaggcaaggcagccagctcaatctcaatgaccacttgcttggccactct
ccaagttccacagctacaagtgggcctggcggaggcagccggcaccgacaggccagcccc
ctggtgcaccggcgggacagcaaccccttcacggagatcgccatgagctcctgcaagtat
agcggtggggtcatgaagcccctcagccgcctcagcgcctcccggaggaacctcatcgag
gccgagactgagggccaacccctccagcttttcagccctagcaaccccccggagatcgtc
atctcctcccgggaggacaaccatgcccaccagaccctgctccatcaccctaatgccacc
cacaaccaccagcatgccggcaccaccgccagcagcaccaccttccccaaagccaacaag
cggaaaaaccaaaacattggctataagctgggacacaggagggccctgtttgaaaagaga
aagcgactgagtgactatgctctgatttttgggatgtttggaattgttgttatggtgata
gagaccgagctctcttggggtttgtactcaaaggactccatgttttcgttggccctgaaa
tgccttatcagtctgtccaccatcatccttttgggcttgatcatcgcctaccacacacgt
gaagtccagctcttcgtgatcgacaatggcgcggatgactggcggatagccatgacctac
gagcgcatcctgtacatcagcctggagatgctggtgtgcgccatccaccccattcctggc
gagtacaagttcttctggacggcacgcctggccttctcctacacaccctcccgggcggag
gccgatgtggacatcatcctgtctatccccatgttcctgcgcctgtacctgatcgcccga
gtcatgctgctgcacagcaagctcttcaccgatgcctcgtcccgcagcatcggggccctc
aacaagatcaacttcaacacccgctttgtcatgaagacgctcatgaccatctgccctggc
actgtgctgctcgtgttcagcatctctctgtggatcattgctgcctggaccgtccgtgtc
tgtgaaaggtaccatgaccagcaggacgtaactagtaactttctgggtgccatgtggctc
atctccatcacattcctttccattggttatggggacatggtgccccacacatactgtggg
aaaggtgtctgtctcctcactggcatcatgggtgcaggctgcactgcccttgtggtggcc
gtggtggcccgaaagctggaactcaccaaagcggagaagcacgttcataacttcatgatg
gacactcagctcaccaagcggatcaagaatgctgcagccaatgtccttcgggaaacatgg
ttaatctataaacacacaaagctgctaaagaagattgaccatgccaaagtgaggaaacac
cagaggaagttcctccaagctatccaccagttgaggagcgtcaagatggaacagaggaag
ctgagtgaccaagccaacactctggtggacctttccaagatgcagaatgtcatgtatgac
ttaatcacagaactcaatgaccggagcgaagacctggagaagcagattggcagcctggag
tcgaagctggagcatctcaccgccagcttcaactccctgccgctgctcatcgccgacacc
ctgcgccagcagcagcagcagctcctgtctgccatcatcgaggcccggggtgtcagcgtg
gcagtgggcaccacccacaccccaatctccgatagccccattggggtcagctccacctcc
ttcccgaccccgtacacaagttcaagcagttgctaa

KEGG   Homo sapiens (human): 3783
Entry
3783              CDS       T01001                                 

Gene name
KCNN4, DHS2, IK, IK1, IKCA1, KCA4, KCa3.1, SK4, hIKCa1, hKCa4, hSK4
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 4
  KO
K04945  potassium intermediate/small conductance calcium-activated channel subfamily N member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
hsa04929  GnRH secretion
hsa04970  Salivary secretion
hsa04974  Protein digestion and absorption
Disease
H00232  Hereditary stomatocytosis
H01978  Dehydrated hereditary stomatocytosis
Drug target
Senicapoc: D06640
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3783 (KCNN4)
   04929 GnRH secretion
    3783 (KCNN4)
  09154 Digestive system
   04970 Salivary secretion
    3783 (KCNN4)
   04974 Protein digestion and absorption
    3783 (KCNN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3783 (KCNN4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   3783 (KCNN4)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 3783
NCBI-ProteinID: NP_002241
OMIM: 602754
HGNC: 6293
Ensembl: ENSG00000104783
Vega: OTTHUMG00000182779
Pharos: O15554(Tchem)
UniProt: O15554
LinkDB
Structure
PDB: 
6D42 6CNM 6CNN 6CNO

Position
19q13.31
AA seq 427 aa
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggcggggatctggtgcttggcctgggggccttgagacgccgaaagcgcttgctggag
caggagaagtctctggccggctgggcactggtgctggcaggaactggcattggactcatg
gtgctgcatgcagagatgctgtggttcggggggtgctcgtgggcgctctacctgttcctg
gttaaatgcacgatcagcatttccaccttcttactcctctgcctcatcgtggcctttcat
gccaaagaggtccagctgttcatgaccgacaacgggctgcgggactggcgcgtggcgctg
accgggcggcaggcggcgcagatcgtgctggagctggtggtgtgtgggctgcacccggcg
cccgtgcggggcccgccgtgcgtgcaggatttaggggcgccgctgacctccccgcagccc
tggccgggattcctgggccaaggggaagcgctgctgtccctggccatgctgctgcgtctc
tacctggtgccccgcgccgtgctcctgcgcagcggcgtcctgctcaacgcttcctaccgc
agcatcggcgctctcaatcaagtccgcttccgccactggttcgtggccaagctttacatg
aacacgcaccctggccgcctgctgctcggcctcacgcttggcctctggctgaccaccgcc
tgggtgctgtccgtggccgagaggcaggctgttaatgccactgggcacctttcagacaca
ctttggctgatccccatcacattcctgaccatcggctatggtgacgtggtgccgggcacc
atgtggggcaagatcgtctgcctgtgcactggagtcatgggtgtctgctgcacagccctg
ctggtggccgtggtggcccggaagctggagtttaacaaggcagagaagcacgtgcacaac
ttcatgatggatatccagtataccaaagagatgaaggagtccgctgcccgagtgctacaa
gaagcctggatgttctacaaacatactcgcaggaaggagtctcatgctgcccgcaggcat
cagcgcaagctgctggccgccatcaacgcgttccgccaggtgcggctgaaacaccggaag
ctccgggaacaagtgaactccatggtggacatctccaagatgcacatgatcctgtatgac
ctgcagcagaatctgagcagctcacaccgggccctggagaaacagattgacacgctggcg
gggaagctggatgccctgactgagctgcttagcactgccctggggccgaggcagcttcca
gaacccagccagcagtccaagtag

DBGET integrated database retrieval system