KEGG   Homo sapiens (human): 3781
Entry
3781              CDS       T01001                                 

Gene name
KCNN2, KCa2.2, SK2, SKCA2, SKCa_2, hSK2
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 2
  KO
K04943  potassium intermediate/small conductance calcium-activated channel subfamily N member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04911  Insulin secretion
hsa04929  GnRH secretion
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3781 (KCNN2)
   04929 GnRH secretion
    3781 (KCNN2)
  09154 Digestive system
   04976 Bile secretion
    3781 (KCNN2)
  09156 Nervous system
   04726 Serotonergic synapse
    3781 (KCNN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3781 (KCNN2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   3781 (KCNN2)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 Med9 YvrJ IRK
Other DBs
NCBI-GeneID: 3781
NCBI-ProteinID: NP_067627
OMIM: 605879
HGNC: 6291
Ensembl: ENSG00000080709
Vega: OTTHUMG00000128836
Pharos: Q9H2S1(Tchem)
UniProt: Q9H2S1
LinkDB
Structure
PDB: 
5V03 5V02 5WBX 5WC5 6ALE

Position
5q22.3
AA seq 791 aa
METPLQFQRGFFPEQPPPPPRSSHLHCQQQQQSQDKPCPPFAPLPHPHHHPHLAHQQPAS
GGSSPCLRCNSCASSGAPAAGAGDNLSLLLRTSSPGGAFRTRTSSPLSGSSCCCCCCSSR
RGSQLNVSELTPSSHASALRQQYAQQSAQQSASASQYHQCHSLQPAASPTGSLGSLGSGP
PLSHHHHHPHPAHHQHHQPQARRESNPFTEIAMSSCRYNGGVMRPLSNLSASRRNLHEMD
SEAQPLQPPASVGGGGGASSPSAAAAAAAAVSSSAPEIVVSKPEHNNSNNLALYGTGGGG
STGGGGGGGGSGHGSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVV
MVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIA
MTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYL
IARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWT
VRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKV
RKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIV
TLETKLETLIGSIHALPGLISQTIRQQQRDFIEAQMESYDKHVTYNAERSRSSSRRRRSS
STAPPTSSESS
NT seq 2376 nt   +upstreamnt  +downstreamnt
atggaaaccccattgcagttccagcgcggcttcttcccagagcagccgccgccgccgccg
cgctcctcacacctgcattgccagcagcagcaacagagccaggacaagccgtgcccgccc
ttcgcgcccctcccgcaccctcaccaccacccgcacctcgcgcaccagcagccggccagc
ggcggcagcagcccatgcctccggtgcaacagctgcgcctcctccggtgccccggcggcg
ggggcgggagataacctgtccctgctgctccgcacctcctcgcccggcggcgccttccgg
acccgcacctcctcgccgctgtcgggctcgtcctgctgctgctgctgctgctcgtcgcgc
cggggcagccagctcaatgtgagcgagctgacgccgtccagccatgccagtgcgctccgg
cagcagtacgcgcagcagtccgcgcagcagtcggcgtccgcctcccagtaccaccagtgc
cacagcctgcagcccgccgccagccccacgggcagcctcggcagtctgggctccgggccc
ccgctctcgcaccaccaccaccacccgcacccggcgcaccaccagcaccaccagccccag
gcgcgccgcgagagcaaccccttcaccgaaatagccatgagcagctgcaggtacaacggg
ggcgtcatgcggccgctcagcaacttgagcgcgtcccgccggaacctgcacgagatggac
tcagaggcgcagcccctgcagccccccgcgtctgtcggaggaggtggcggcgcgtcctcc
ccgtctgcagccgctgccgccgccgccgctgtttcgtcctcagcccccgagatcgtggtg
tctaagcccgagcacaacaactccaacaacctggcgctctatggaaccggcggcggaggc
agcactggaggaggcggcggcggtggcgggagcgggcacggcagcagcagtggcaccaag
tccagcaaaaagaaaaaccagaacatcggctacaagctgggccaccggcgcgccctgttc
gaaaagcgcaagcggctcagcgactacgcgctcatcttcggcatgttcggcatcgtggtc
atggtcatcgagaccgagctgtcgtggggcgcctacgacaaggcgtcgctgtattcctta
gctctgaaatgccttatcagtctctccacgatcatcctgctcggtctgatcatcgtgtac
cacgccagggaaatacagttgttcatggtggacaatggagcagatgactggagaatagcc
atgacttatgagcgtattttcttcatctgcttggaaatactggtgtgtgctattcatccc
atacctgggaattatacattcacatggacggcccggcttgccttctcctatgccccatcc
acaaccaccgctgatgtggatattattttatctataccaatgttcttaagactctatctg
attgccagagtcatgcttttacatagcaaacttttcactgatgcctcctctagaagcatt
ggagcacttaataagataaacttcaatacacgttttgttatgaagactttaatgactata
tgcccaggaactgtactcttggtttttagtatctcattatggataattgccgcatggact
gtccgagcttgtgaaaggtaccatgatcaacaggatgttactagcaacttccttggagcg
atgtggttgatatcaataacttttctctccattggttatggtgacatggtacctaacaca
tactgtggaaaaggagtctgcttacttactggaattatgggtgctggttgcacagccctg
gtggtagctgtagtggcaaggaagctagaacttaccaaagcagaaaaacacgtgcacaat
ttcatgatggatactcagctgactaaaagagtaaaaaatgcagctgccaatgtactcagg
gaaacatggctaatttacaaaaatacaaagctagtgaaaaagatagatcatgcaaaagta
agaaaacatcaacgaaaattcctgcaagctattcatcaattaagaagtgtaaaaatggag
cagaggaaactgaatgaccaagcaaacactttggtggacttggcaaagacccagaacatc
atgtatgatatgatttctgacttaaacgaaaggagtgaagacttcgagaagaggattgtt
accctggaaacaaaactagagactttgattggtagcatccacgccctccctgggctcata
agccagaccatcaggcagcagcagagagatttcattgaggctcagatggagagctacgac
aagcacgtcacttacaatgctgagcggtcccggtcctcgtccaggaggcggcggtcctct
tccacagcaccaccaacttcatcagagagtagctag

DBGET integrated database retrieval system