KEGG   Homo sapiens (human): 3802Help
Entry
3802              CDS       T01001                                 

Gene name
KIR2DL1, CD158A, KIR-K64, KIR221, KIR2DL3, NKAT, NKAT-1, NKAT1, p58.1
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1
  KO
K07981  killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3802 (KIR2DL1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3802 (KIR2DL1)
   04612 Antigen processing and presentation
    3802 (KIR2DL1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3802 (KIR2DL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3802 (KIR2DL1)
CD molecules [BR:hsa04090]
 Proteins
  3802 (KIR2DL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2 DUF5589
Motif
Other DBs
NCBI-GeneID: 3802
NCBI-ProteinID: NP_055033
OMIM: 604936
HGNC: 6329
Ensembl: ENSG00000125498
Vega: OTTHUMG00000065885
Pharos: P43626(Tbio)
UniProt: P43626 Q6H2H3 Q6H2H2
LinkDB All DBs
Structure
PDB: 

Position
19q13.42
AA seq 348 aa AA seqDB search
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDI
VIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGT
FQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcttggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcagtgttggtcagatgtcatgtttgaacacttccttctg
cacagagaggggatgtttaacgacactttgcgcctcattggagaacaccatgatggggtc
tccaaggccaacttctccatcagtcgcatgacgcaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcaggtgtcagctcccagtgaccctctggacatc
gtgatcataggtctatatgagaaaccttctctctcagcccagctgggccccacggttctg
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggcccaaggtcaacggaaca
ttccaggctgactttcctctgggccctgccacccacggagggacctacagatgcttcggc
tctttccatgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcaggaaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

KEGG   Homo sapiens (human): 3803Help
Entry
3803              CDS       T01001                                 

Gene name
KIR2DL2, CD158B1, CD158b, NKAT-6, NKAT6, p58.2
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 2
  KO
K07981  killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3803 (KIR2DL2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3803 (KIR2DL2)
   04612 Antigen processing and presentation
    3803 (KIR2DL2)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3803 (KIR2DL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3803 (KIR2DL2)
CD molecules [BR:hsa04090]
 Proteins
  3803 (KIR2DL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2 DUF5589 SIT
Motif
Other DBs
NCBI-GeneID: 3803
NCBI-ProteinID: NP_055034
OMIM: 604937
HGNC: 6330
Pharos: P43627(Tdark)
UniProt: P43627 Q8N742 Q6H2H0
LinkDB All DBs
Structure
PDB: 

Position
19q13.4
AA seq 348 aa AA seqDB search
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttgagcacttccttctg
cacagagaagggaagtttaaggacactttgcacctcattggagagcaccatgatggggtc
tccaaagccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaatgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctctaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcagggaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

KEGG   Homo sapiens (human): 3804Help
Entry
3804              CDS       T01001                                 

Gene name
KIR2DL3, CD158B2, CD158b, GL183, KIR-023GB, KIR-K7b, KIR-K7c, KIR2DL, KIR2DS5, KIRCL23, NKAT, NKAT2, NKAT2A, NKAT2B, p58
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3
  KO
K07981  killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3804 (KIR2DL3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3804 (KIR2DL3)
   04612 Antigen processing and presentation
    3804 (KIR2DL3)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3804 (KIR2DL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3804 (KIR2DL3)
CD molecules [BR:hsa04090]
 Proteins
  3804 (KIR2DL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2 SIT
Motif
Other DBs
NCBI-GeneID: 3804
NCBI-ProteinID: NP_056952
OMIM: 604938
HGNC: 6331
Ensembl: ENSG00000243772
Vega: OTTHUMG00000065887
Pharos: P43628(Tbio)
UniProt: P43628 E3NZD8
LinkDB All DBs
Structure
PDB: 

Position
19q13.42
AA seq 341 aa AA seqDB search
MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDPQE
VTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggtgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcccctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttcagcacttccttctg
cacagagaagggaagtttaaggacactttgcacctcattggagagcaccatgatggggtc
tccaaggccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaacgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctgcatgttctgattgggacctcagtggtcatcatcctcttcatcctcctc
ctcttctttctccttcatcgctggtgctgcaacaaaaaaaatgctgttgtaatggaccaa
gagcctgcagggaacagaacagtgaacagggaggactctgatgaacaagaccctcaggag
gtgacatatgcacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttct
cagaggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgag
ccctga

KEGG   Homo sapiens (human): 3805Help
Entry
3805              CDS       T01001                                 

Gene name
KIR2DL4, CD158D, G9P, KIR-103AS, KIR-2DL4, KIR103, KIR103AS
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
  KO
K07981  killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3805 (KIR2DL4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3805 (KIR2DL4)
   04612 Antigen processing and presentation
    3805 (KIR2DL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3805 (KIR2DL4)
CD molecules [BR:hsa04090]
 Proteins
  3805 (KIR2DL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_2 Ig_3 V-set
Motif
Other DBs
NCBI-GeneID: 3805
NCBI-ProteinID: NP_002246
OMIM: 604945
HGNC: 6332
Ensembl: ENSG00000189013
Vega: OTTHUMG00000065880
Pharos: Q99706(Tbio)
UniProt: Q99706
LinkDB All DBs
Structure
PDB: 

Position
19q13.42
AA seq 377 aa AA seqDB search
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIF
TLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVT
GLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQA
DFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARH
LHAVIRYSVAIILFTILPFFLLHRWCSKKKNAAVMNQEPAGHRTVNREDSDEQDPQEVTY
AQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETT
ALSQTQLASSNVPAAGI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgtcacccacggtcatcatcctggcatgtcttgggttcttcttggaccagagt
gtgtgggcacacgtgggtggtcaggacaagcccttctgctctgcctggcccagcgctgtg
gtgcctcaaggaggacacgtgactcttcggtgtcactatcgtcgtgggtttaacatcttc
acgctgtacaagaaagatggggtccctgtccctgagctctacaacagaatattctggaac
agtttcctcattagccctgtgaccccagcacacgcagggacctacagatgtcgaggtttt
cacccgcactcccccactgagtggtcggcacccagcaaccccctggtgatcatggtcaca
ggtctatatgagaaaccttcgcttacagcccggccgggccccacggttcgcgcaggagag
aacgtgaccttgtcctgcagctcccagagctcctttgacatctaccatctatccagggag
ggggaagcccatgaacttaggctccctgcagtgcccagcatcaatggaacattccaggcc
gacttccctctgggtcctgccacccacggagagacctacagatgcttcggctctttccat
ggatctccctacgagtggtcagacccgagtgacccactgcctgtttctgtcacaggaaac
ccttctagtagttggccttcacccactgaaccaagcttcaaaactggtatcgccagacac
ctgcatgctgtgattaggtactcagtggccatcatcctctttaccatccttcccttcttt
ctccttcatcgctggtgctccaaaaaaaaaaatgctgctgtaatgaaccaagagcctgcg
ggacacagaacagtgaacagggaggactctgatgaacaagaccctcaggaggtgacatac
gcacagttggatcactgcattttcacacagagaaaaatcactggcccttctcagaggagc
aagagaccctcaacagataccagcgtgtgtatagaacttccaaatgctgagcccagagcg
ttgtctcctgcccatgagcaccacagtcaggccttgatgggatcttctagggagacaaca
gccctgtctcaaacccagcttgccagctctaatgtaccagcagctggaatctga

KEGG   Homo sapiens (human): 57292Help
Entry
57292             CDS       T01001                                 

Gene name
KIR2DL5A, CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 5A
  KO
K07981  killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    57292 (KIR2DL5A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    57292 (KIR2DL5A)
   04612 Antigen processing and presentation
    57292 (KIR2DL5A)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    57292 (KIR2DL5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    57292 (KIR2DL5A)
CD molecules [BR:hsa04090]
 Proteins
  57292 (KIR2DL5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_2 Ig_3 V-set Shisa SIT WBP-1 Tweety
Motif
Other DBs
NCBI-GeneID: 57292
NCBI-ProteinID: NP_065396
OMIM: 605305
HGNC: 16345
Pharos: Q8N109(Tdark)
UniProt: Q8N109 A0A191URI1
LinkDB All DBs
Position
19p13.3
AA seq 375 aa AA seqDB search
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSL
YKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGL
FGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADF
PLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQ
LDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTAL
SQNRVASSHVPAAGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
acacatgagggtggtcaggacaagcccttgctgtctgcctggcccagcgctgtggtgcct
cgaggaggacatgtgactcttctgtgtcgctctcgtcttgggtttaccatcttcagtctg
tacaaagaagatggggtgcctgtccctgagctctacaacaaaatattctggaagagcatc
ctcatgggccctgtgacccctgcacacgcagggacctacagatgtcggggttcacaccca
cgctcccccattgagtggtcagcacccagcaaccccctggtgatcgtggtcacaggtcta
tttgggaaaccttcactctcagcccagccgggccccacggttcgcacaggagagaacgtg
accttgtcctgcagctccaggagctcatttgacatgtaccatctatccagggaggggagg
gcccatgaacctaggctccctgcagtgcccagcgtcaatggaacattccaggctgacttt
cctctgggccctgccacccacggagggacctacacatgcttcggctctctccatgactca
ccctatgagtggtcagacccgagtgacccactgcttgtttctgtcacaggaaactcttca
agtagttcatcttcacccactgaaccaagctccaaaactggtatccgcagacacctgcac
attctgattgggacctcagtggctatcatcctcttcatcatcctcttcttctttctcctt
cattgctgctgctccaacaaaaagaatgctgctgtaatggaccaagagcctgccggggac
agaacagtgaacagggaggactctgatgatcaagaccctcaggaggtgacatatgcacag
ttggatcactgcgttttcacacagacaaaaatcacttccccttctcagaggcccaagaca
cctccaacagataccaccatgtacatggaacttccaaatgctaagccaagatcattgtct
cctgcccataagcaccacagtcaggccttgaggggatcttctagggagacaacagccctg
tctcaaaaccgggttgctagctcccatgtaccagcagctggaatctga

DBGET integrated database retrieval system