KEGG   Homo sapiens (human): 3814
Entry
3814              CDS       T01001                                 

Gene name
KISS1, HH13, KiSS-1
Definition
(RefSeq) KiSS-1 metastasis suppressor
  KO
K23140  metastasis-suppressor KiSS-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04929  GnRH secretion
Network
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00869  KISS1-KISS1R-PLCB-PKC signaling pathway
N00870  Mutation-inactivated KISS1 to KISS1-KISS1R-PLCB-PKC signaling pathway
N00871  Mutation-inactivated KISS1R to KISS1-KISS1R-PLCB-PKC signaling pathway
N00872  Mutation-activated KISS1R to KISS1-KISS1R-PLCB-PKC signaling pathway
Disease
H00255  Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3814 (KISS1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    3814 (KISS1)
SSDB
Motif
Pfam: Kisspeptin RFamide_26RFa
Other DBs
NCBI-GeneID: 3814
NCBI-ProteinID: NP_002247
OMIM: 603286
HGNC: 6341
Ensembl: ENSG00000170498
Vega: OTTHUMG00000036060
Pharos: Q15726(Tbio)
CPD: C16090 C16091 C16092 C16093
UniProt: Q15726
LinkDB
Position
1q32.1
AA seq 138 aa
MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAA
TARLSRRGTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLR
FGKREAAPGNHGRSAGRG
NT seq 417 nt   +upstreamnt  +downstreamnt
atgaactcactggtttcttggcagctactgcttttcctctgtgccacccactttggggag
ccattagaaaaggtggcctctgtggggaattctagacccacaggccagcagctagaatcc
ctgggcctcctggcccccggggagcagagcctgccgtgcaccgagaggaagccagctgct
actgccaggctgagccgtcgggggacctcgctgtccccgccccccgagagctccgggagc
ccccagcagccgggcctgtccgccccccacagccgccagatccccgcaccccagggcgcg
gtgctggtgcagcgggagaaggacctgccgaactacaactggaactccttcggcctgcgc
ttcggcaagcgggaggcggcaccagggaaccacggcagaagcgctgggcggggctga

DBGET integrated database retrieval system