KEGG   Homo sapiens (human): 3816
Entry
3816              CDS       T01001                                 

Gene name
KLK1, KLKR, Klk6, hK1
Definition
(RefSeq) kallikrein 1
  KO
K01325  tissue kallikrein [EC:3.4.21.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04961  Endocrine and other factor-regulated calcium reabsorption
Drug target
Gabexate (DG01400): D01672<JP> D08004
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    3816 (KLK1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    3816 (KLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3816 (KLK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3816 (KLK1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.35  tissue kallikrein
     3816 (KLK1)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   3816 (KLK1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3816 (KLK1)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 3816
NCBI-ProteinID: NP_002248
OMIM: 147910
HGNC: 6357
Ensembl: ENSG00000167748
Vega: OTTHUMG00000182876
Pharos: P06870(Tchem)
UniProt: P06870 A0A1R3UCD2
LinkDB
Structure
PDB: 
1SPJ

Position
19q13.33
AA seq 262 aa
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtggttcctggttctgtgcctcgccctgtccctgggggggactggtgctgcgcccccg
attcagtcccggattgtgggaggctgggagtgtgagcagcattcccagccctggcaggcg
gctctgtaccatttcagcactttccagtgtgggggcatcctggtgcaccgccagtgggtg
ctcacagctgctcattgcatcagcgacaattaccagctctggctgggtcgccacaacttg
tttgacgacgaaaacacagcccagtttgttcatgtcagtgagagcttcccacaccctggc
ttcaacatgagcctcctggagaaccacacccgccaagcagacgaggactacagccacgac
ctcatgctgctccgcctgacagagcctgctgataccatcacagatgctgtgaaggtcgtg
gagttgcccaccgaggaacccgaagtggggagcacctgtttggcttccggctggggcagc
atcgaaccagagaatttctcatttccagatgatctccagtgtgtggacctcaaaatcctg
cctaatgatgagtgcaaaaaagcccacgtccagaaggtgacagacttcatgctgtgtgtc
ggacacctggaaggtggcaaagacacctgtgtgggtgattcagggggcccgctgatgtgt
gatggtgtgctccaaggtgtcacatcatggggctacgtcccttgtggcacccccaataag
ccttctgtcgccgtcagagtgctgtcttatgtgaagtggatcgaggacaccatagcggag
aactcctga

KEGG   Homo sapiens (human): 3817
Entry
3817              CDS       T01001                                 

Gene name
KLK2, KLK2A2, hGK-1, hK2
Definition
(RefSeq) kallikrein related peptidase 2
  KO
K01325  tissue kallikrein [EC:3.4.21.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04961  Endocrine and other factor-regulated calcium reabsorption
Drug target
Gabexate (DG01400): D01672<JP> D08004
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    3817 (KLK2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    3817 (KLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3817 (KLK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3817 (KLK2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.35  tissue kallikrein
     3817 (KLK2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   3817 (KLK2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3817 (KLK2)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 3817
NCBI-ProteinID: NP_005542
OMIM: 147960
HGNC: 6363
Ensembl: ENSG00000167751
Vega: OTTHUMG00000182963
Pharos: P20151(Tbio)
UniProt: P20151 A0A024R4J4 B4DU77
LinkDB
Structure
PDB: 
4NFE 4NFF

Position
19q13.33
AA seq 261 aa
MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWV
LTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHD
LMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLS
NDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKP
AVYTKVVHYRKWIKDTIAANP
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtgggacctggttctctccatcgccttgtctgtggggtgcactggtgccgtgcccctc
atccagtctcggattgtgggaggctgggagtgtgagaagcattcccaaccctggcaggtg
gctgtgtacagtcatggatgggcacactgtgggggtgtcctggtgcacccccagtgggtg
ctcacagctgcccattgcctaaagaagaatagccaggtctggctgggtcggcacaacctg
tttgagcctgaagacacaggccagagggtccctgtcagccacagcttcccacacccgctc
tacaatatgagccttctgaagcatcaaagccttagaccagatgaagactccagccatgac
ctcatgctgctccgcctgtcagagcctgccaagatcacagatgttgtgaaggtcctgggc
ctgcccacccaggagccagcactggggaccacctgctacgcctcaggctggggcagcatc
gaaccagaggagttcttgcgccccaggagtcttcagtgtgtgagcctccatctcctgtcc
aatgacatgtgtgctagagcttactctgagaaggtgacagagttcatgttgtgtgctggg
ctctggacaggtggtaaagacacttgtgggggtgattctgggggtccacttgtctgtaat
ggtgtgcttcaaggtatcacatcatggggccctgagccatgtgccctgcctgaaaagcct
gctgtgtacaccaaggtggtgcattaccggaagtggatcaaggacaccatcgcagccaac
ccctga

DBGET integrated database retrieval system