KEGG   Homo sapiens (human): 382Help
Entry
382               CDS       T01001                                 

Gene name
ARF6
Definition
(RefSeq) ADP ribosylation factor 6
  KO
K07941  ADP-ribosylation factor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    382 (ARF6)
   04072 Phospholipase D signaling pathway
    382 (ARF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    382 (ARF6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    382 (ARF6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    382 (ARF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    382 (ARF6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    382 (ARF6)
   04031 GTP-binding proteins [BR:hsa04031]
    382 (ARF6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    382 (ARF6)
  Arf GTPases and associated proteins
   Arf GTPases
    382 (ARF6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   382 (ARF6)
  Exosomal proteins of colorectal cancer cells
   382 (ARF6)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    382 (ARF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Roc Ras SRPRB G-alpha Gtr1_RagA MMR_HSR1 6PF2K SpoOE-like CRISPR_Cas2
Motif
Other DBs
NCBI-GeneID: 382
NCBI-ProteinID: NP_001654
OMIM: 600464
HGNC: 659
Ensembl: ENSG00000165527
Vega: OTTHUMG00000140296
Pharos: P62330(Tbio)
UniProt: P62330
LinkDB All DBs
Structure
PDB: 

Position
14q21.3
AA seq 175 aa AA seqDB search
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtgctatccaaaatcttcgggaacaaggaaatgcggatcctcatgttgggc
ctggacgcggccggcaagacaacaatcctgtacaagttgaagctgggccagtcggtgacc
accattcccactgtgggtttcaacgtggagacggtgacttacaaaaatgtcaagttcaac
gtatgggatgtgggcggccaggacaagatccggccgctctggcggcattactacactggg
acccaaggtctcatcttcgtagtggactgcgccgaccgcgaccgcatcgatgaggctcgc
caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc
gccaacaagcaggacctgcccgatgccatgaaaccccacgagatccaggagaaactgggc
ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctcaggggac
ggactctatgaggggctcacatggttaacctctaactacaaatcttaa

DBGET integrated database retrieval system