KEGG   Homo sapiens (human): 3827Help
Entry
3827              CDS       T01001                                 

Gene name
KNG1, BDK, BK, HMWK, KNG
Definition
(RefSeq) kininogen 1
  KO
K03898  kininogen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05200  Pathways in cancer
Drug target
Kallidinogenase: D03330
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    3827 (KNG1)
   04022 cGMP-PKG signaling pathway
    3827 (KNG1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3827 (KNG1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3827 (KNG1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3827 (KNG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3827 (KNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3827 (KNG1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    3827 (KNG1)
   05143 African trypanosomiasis
    3827 (KNG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3827 (KNG1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   3827 (KNG1)
  Exosomal proteins of other cancer cells
   3827 (KNG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin Cathelicidins Spp-24 Bradykinin
Motif
Other DBs
NCBI-GeneID: 3827
NCBI-ProteinID: NP_001095886
OMIM: 612358
HGNC: 6383
Ensembl: ENSG00000113889
Vega: OTTHUMG00000150348
Pharos: P01042(Tbio)
CPD: C00306 C16008 C01505
UniProt: P01042
LinkDB All DBs
Position
3q27.3
AA seq 644 aa AA seqDB search
MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT
EATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFS
VATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLN
EVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLR
IASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
IDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPW
EKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSG
KEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLD
DDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQE
KTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSF
NPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaattaccatccttttcctctgctccaggctgctactaagtttaacccaggaa
tcacagtccgaggaaattgactgcaatgacaaggatttatttaaagctgtggatgctgct
ctgaagaaatataacagtcaaaaccaaagtaacaaccagtttgtattgtaccgcataact
gaagccactaagacggttggctctgacacgttttattccttcaagtacgaaatcaaggag
ggggattgtcctgttcaaagtggcaaaacctggcaggactgtgagtacaaggatgctgca
aaagcagccactggagaatgcacggcaaccgtggggaagaggagcagtacgaaattctcc
gtggctacccagacctgccagattactccagccgagggccctgtggtgacagcccagtac
gactgcctcggctgtgtgcatcctatatcaacgcagagcccagacctggagcccattctg
agacacggcattcagtactttaacaacaacactcaacattcctccctcttcatgcttaat
gaagtaaaacgggcccaaagacaggtggtggctggattgaactttcgaattacctactca
attgtgcaaacgaattgttccaaagagaattttctgttcttaactccagactgcaagtcc
ctttggaatggtgataccggtgaatgtacagataatgcatacatcgatattcagctacga
attgcttccttctcacagaactgtgacatttatccagggaaggattttgtacaaccacct
accaagatttgcgtgggctgccccagagatatacccaccaacagcccagagctggaggag
acactgactcacaccatcacaaagcttaatgcagagaataacgcaactttctatttcaag
attgacaatgtgaaaaaagcaagagtacaggtggtggctggcaagaaatattttattgac
ttcgtggccagggaaaccacatgttccaaggaaagtaatgaagagttgaccgaaagctgt
gagaccaaaaaacttggccaaagcctagattgcaacgctgaagtttatgtggtaccctgg
gagaaaaaaatttaccctactgtcaactgtcaaccactgggaatgatctcactgatgaaa
aggcctccaggtttttcacctttccgatcatcacgaataggggaaataaaagaagaaaca
actgtaagtccaccccacacttccatggcacctgcacaagatgaagagcgggattcagga
aaagaacaagggcatactcgtagacatgactggggccatgaaaaacaaagaaaacataat
cttggccatggccataaacatgaacgtgaccaagggcatgggcaccaaagaggacatggc
cttggccatggacacgaacaacagcatggtcttggtcatggacataagttcaaacttgat
gatgatcttgaacaccaagggggccatgtccttgaccatggacataagcataagcatggt
catggccacggaaaacataaaaataaaggcaaaaagaatggaaagcacaatggttggaaa
acagagcatttggcaagctcttctgaagacagtactacaccttctgcacagacacaagag
aagacagaagggccaacacccatcccttccctagccaagccaggtgtaacagttaccttt
tctgactttcaggactctgatctcattgcaactatgatgcctcctatatcaccagctccc
atacagagtgatgacgattggatccctgatatccagatagacccaaatggcctttcattt
aacccaatatcagattttccagacacgacctccccaaaatgtcctggacgcccctggaag
tcagttagtgaaattaatccaaccacacaaatgaaagaatcttattatttcgatctcact
gatggcctttcttaa

DBGET integrated database retrieval system