KEGG   Homo sapiens (human): 3836
Entry
3836              CDS       T01001                                 

Gene name
KPNA1, IPOA5, NPI-1, RCH2, SRP1
Definition
(RefSeq) karyopherin subunit alpha 1
  KO
K23940  importin subunit alpha-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
hsa05164  Influenza A
Network
nt06123  TNF signaling (viruses and bacteria)
  Element
N01118  Salmonella SpvD to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    3836 (KPNA1)
  09172 Infectious disease: viral
   05164 Influenza A
    3836 (KPNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3836 (KPNA1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    3836 (KPNA1)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_2 HEAT_EZ HEAT V-ATPase_H_C Arm_2 V-ATPase_H_N FmdE
Other DBs
NCBI-GeneID: 3836
NCBI-ProteinID: NP_002255
OMIM: 600686
HGNC: 6394
Ensembl: ENSG00000114030
Vega: OTTHUMG00000159487
Pharos: P52294(Tbio)
UniProt: P52294
LinkDB
Structure
PDB: 
2JDQ 4B18 3TJ3

Position
3q21.1
AA seq 538 aa
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEE
VMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDE
VISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSS
EFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLC
RGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACW
TISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDK
IEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgaccaccccaggaaaagagaactttcgcctgaaaagttacaagaacaaatctctgaat
cccgatgagatgcgcaggaggagggaggaagaaggactgcagttacgaaagcagaaaaga
gaagagcagttattcaagcggagaaatgttgctacagcagaagaagaaacagaagaagaa
gttatgtcagatggaggctttcatgaggctcagattagtaacatggagatggcaccaggt
ggtgtcatcacttctgacatgattgaaatgatattttccaaaagcccagagcaacagctt
tcagcaacacagaaattcaggaagctgctttcaaaagaacctaaccctcctattgatgaa
gttatcagcacaccaggagtagtggccaggtttgtggagttcctcaaacgaaaagagaat
tgtacactgcagtttgaatcagcttgggtactgacaaatattgcttcaggaaattctctt
cagacccgaattgtgattcaggcaggagctgtgcccatcttcatagagttgctcagctca
gagtttgaagatgtccaggaacaggcagtctgggctcttggcaacattgctggagatagt
accatgtgcagggactatgtcttagactgcaatatccttccccctcttttgcagttattt
tcaaagcaaaaccgcctgaccatgacccggaatgcagtatgggctttgtctaatctctgt
agagggaaaagtccacctccagaatttgcaaaggtttctccatgtctgaatgtgctttcc
tggttgctgtttgtcagtgacactgatgtactggctgatgcctgctgggccctctcatat
ctatcagatggacccaatgataaaattcaagcggtcatcgatgcgggagtatgtaggaga
cttgtggaactgctgatgcataatgattataaagtggtttctcctgctttgcgagctgtg
ggaaacattgtcacaggggatgatattcagacacaggtaattctgaattgctcagctctg
cagagtttattgcatttgctgagtagcccaaaggaatctatcaaaaaggaagcatgttgg
acgatatctaatattacagctggaaatagggcacagatccagactgtgatagatgccaac
attttcccagccctcattagtattttacaaactgctgaatttcggacaagaaaagaagca
gcttgggccatcacaaatgcaacttctggaggatcagctgaacagatcaagtacctagta
gaactgggttgtatcaagccgctctgtgatctcctcacggtcatggactctaagattgta
caggttgccctaaatggcttggaaaatatcctgaggcttggagaacaggaagccaaaagg
aatggcactggcattaacccttactgtgctttgattgaagaagcttatggtctggataaa
attgagttcttacagagtcatgaaaaccaggagatctaccaaaaggcctttgatcttatt
gagcattacttcgggaccgaagatgaagacagcagcattgcaccccaggttgaccttaac
cagcagcagtacatcttccaacagtgtgaggctcctatggaaggtttccagctttga

KEGG   Homo sapiens (human): 3839
Entry
3839              CDS       T01001                                 

Gene name
KPNA3, IPOA4, SRP1, SRP1gamma, SRP4, hSRP1
Definition
(RefSeq) karyopherin subunit alpha 3
  KO
K23583  importin subunit alpha-4/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06123  TNF signaling (viruses and bacteria)
  Element
N01118  Salmonella SpvD to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    3839 (KPNA3)
SSDB
Motif
Pfam: Arm HEAT_EZ Arm_3 IBB HEAT_2 HEAT Adaptin_N Cnd1 V-ATPase_H_N Mo25 DCB
Other DBs
NCBI-GeneID: 3839
NCBI-ProteinID: NP_002258
OMIM: 601892
HGNC: 6396
Ensembl: ENSG00000102753
Vega: OTTHUMG00000016922
Pharos: O00505(Tbio)
UniProt: O00505 A0A024RDV7
LinkDB
Position
13q14.2
AA seq 521 aa
MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDS
DVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
KCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVIVNLCRNKDPPPPMETV
QEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLL
SVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEI
IDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggccgagaaccccagcttggagaaccaccgcatcaagagcttcaagaacaagggccgc
gatgtggaaacaatgcgaagacatagaaatgaagtgacagtggaactgcggaagaacaaa
agagatgaacacttattgaaaaagagaaatgttccccaagaagaaagtctagaagattca
gatgttgatgctgattttaaagcacaaaatgtaaccctagaagctatattgcagaatgcc
acaagtgataacccagtggtccaattgagtgctgtccaggcagcaagaaaactgttatcc
agtgacagaaatccaccgattgatgacttaataaaatctgggattttaccaattctagtc
aaatgtctagaaagggatgataatccttcattacagtttgaagctgcttgggcattaact
aacatagcatcaggaacttctgcacagactcaagctgttgtgcagtctaatgcagtacct
ctttttctgagacttcttcgttcaccacatcagaatgtttgtgaacaagcagtatgggct
ttgggaaacattataggtgatggtcctcaatgtagagattatgtcatatcactgggagtt
gtcaaacctcttctgtccttcatcagtccctccatccccatcaccttccttcggaacgtc
acatgggtcattgtcaatctctgcaggaataaggatcccccgccgcctatggagacagtt
caggagattttgccagctttatgtgtcctcatataccatacagatataaacattcttgta
gacactgtttgggctctgtcatacttgacagatggaggtaatgaacagatacagatggtt
attgattcaggagttgtgccctttcttgtgccccttctgagccatcaggaagtcaaagtt
caaacagcagccctcagagcagttggcaacatagtgactggcaccgacgagcagacccag
gttgttctcaattgtgatgtcctgtcacacttcccaaatctcttatcacacccaaaagag
aagataaataaggaagcagtgtggttcctttccaacataacagcaggcaaccagcaacaa
gttcaagctgtaatagatgctggattaattcctatgataattcatcagcttgctaagggg
gactttggaacacaaaaagaagctgcttgggcaatcagcaacttaacaataagtggcaga
aaagatcaggttgagtaccttgtacagcagaatgtaataccaccgttctgtaatttactg
tcagtgaaagattctcaagtggttcaggtggttctagatggtctaaaaaacattctgata
atggccggtgatgaagcaagcacaatagctgaaataatagaggaatgtggaggtttggag
aaaattgaagttttacagcaacatgaaaatgaagacatatataaattagcatttgaaatc
atagatcagtatttctctggtgatgatattgatgaagatccctgcctcattcctgaagca
acacaaggaggtacctacaattttgatccaacagccaaccttcaaacaaaagaatttaat
ttttaa

DBGET integrated database retrieval system