KEGG   Homo sapiens (human): 387Help
Entry
387               CDS       T01001                                 

Gene name
RHOA, ARH12, ARHA, RHO12, RHOH12
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04150  mTOR signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04972  Pancreatic secretion
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06124  Chemokine signaling (virus)
nt06135  Cytoskeletal regulation (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00408  LPAR-GNB/G-Rho signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    387 (RHOA)
   04015 Rap1 signaling pathway
    387 (RHOA)
   04310 Wnt signaling pathway
    387 (RHOA)
   04350 TGF-beta signaling pathway
    387 (RHOA)
   04072 Phospholipase D signaling pathway
    387 (RHOA)
   04071 Sphingolipid signaling pathway
    387 (RHOA)
   04024 cAMP signaling pathway
    387 (RHOA)
   04022 cGMP-PKG signaling pathway
    387 (RHOA)
   04150 mTOR signaling pathway
    387 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    387 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    387 (RHOA)
   04520 Adherens junction
    387 (RHOA)
   04530 Tight junction
    387 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    387 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    387 (RHOA)
   04621 NOD-like receptor signaling pathway
    387 (RHOA)
   04625 C-type lectin receptor signaling pathway
    387 (RHOA)
   04660 T cell receptor signaling pathway
    387 (RHOA)
   04670 Leukocyte transendothelial migration
    387 (RHOA)
   04062 Chemokine signaling pathway
    387 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    387 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    387 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    387 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    387 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    387 (RHOA)
  09158 Development
   04360 Axon guidance
    387 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    387 (RHOA)
   05206 MicroRNAs in cancer
    387 (RHOA)
   05205 Proteoglycans in cancer
    387 (RHOA)
   05203 Viral carcinogenesis
    387 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    387 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    387 (RHOA)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    387 (RHOA)
   05135 Yersinia infection
    387 (RHOA)
   05133 Pertussis
    387 (RHOA)
   05152 Tuberculosis
    387 (RHOA)
   05100 Bacterial invasion of epithelial cells
    387 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    387 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    387 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    387 (RHOA)
   04031 GTP-binding proteins [BR:hsa04031]
    387 (RHOA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    387 (RHOA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   387 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   387 (RHOA)
  Exosomal proteins of colorectal cancer cells
   387 (RHOA)
  Exosomal proteins of bladder cancer cells
   387 (RHOA)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    387 (RHOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 387
NCBI-ProteinID: NP_001300870
OMIM: 165390
HGNC: 667
Ensembl: ENSG00000067560
Vega: OTTHUMG00000156838
Pharos: P61586(Tbio)
UniProt: P61586 A0A024R324
LinkDB All DBs
Structure
PDB: 

Position
3p21.31
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggaaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag
aactatgtggcagatatcgaggtggatggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata
ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc
ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa
gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system