KEGG   Homo sapiens (human): 387082
Entry
387082            CDS       T01001                                 

Gene name
SUMO4, IDDM5, SMT3H4, SUMO-4, dJ281H8.4
Definition
(RefSeq) small ubiquitin like modifier 4
  KO
K12160  small ubiquitin-related modifier
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    387082 (SUMO4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    387082 (SUMO4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    387082 (SUMO4)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    387082 (SUMO4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    387082 (SUMO4)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   387082 (SUMO4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    387082 (SUMO4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    387082 (SUMO4)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin SRP9-21
Other DBs
NCBI-GeneID: 387082
NCBI-ProteinID: NP_001002255
OMIM: 608829
HGNC: 21181
Ensembl: ENSG00000177688
Vega: OTTHUMG00000015785
Pharos: Q6EEV6(Tbio)
UniProt: Q6EEV6
LinkDB
Position
6q25.1
AA seq 95 aa
MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRF
RFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
NT seq 288 nt   +upstreamnt  +downstreamnt
atggccaacgaaaagcccacagaagaagtcaagactgagaacaacaatcatattaatttg
aaggtggcgggacaggatggttctgtggtgcagtttaagattaagaggcagacaccactt
agtaaactaatgaaagcctattgtgaaccacggggattgtcagtgaagcagatcagattc
cgatttggtgggcaaccaatcagtggaacagacaaacctgcacagttggaaatggaagat
gaagatacaattgatgtgtttcaacagcctacgggaggtgtctactga

KEGG   Homo sapiens (human): 6612
Entry
6612              CDS       T01001                                 

Gene name
SUMO3, SMT3A, SMT3H1, SUMO-3, Smt3B
Definition
(RefSeq) small ubiquitin like modifier 3
  KO
K12160  small ubiquitin-related modifier
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    6612 (SUMO3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6612 (SUMO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    6612 (SUMO3)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    6612 (SUMO3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    6612 (SUMO3)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   6612 (SUMO3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    6612 (SUMO3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    6612 (SUMO3)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin DUF5010_C
Other DBs
NCBI-GeneID: 6612
NCBI-ProteinID: NP_008867
OMIM: 602231
HGNC: 11124
Ensembl: ENSG00000184900
Vega: OTTHUMG00000090256
Pharos: P55854(Tbio)
UniProt: P55854
LinkDB
Structure
PDB: 

Position
21q22.3
AA seq 103 aa
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFR
FDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtccgaggagaagcccaaggagggtgtgaagacagagaatgaccacatcaacctgaag
gtggccgggcaggacggctccgtggtgcagttcaagatcaagaggcacacgccgctgagc
aagctgatgaaggcctactgcgagaggcagggcttgtcaatgaggcagatcagattcagg
ttcgacgggcagccaatcaatgaaactgacactccagcacagctggagatggaggacgag
gacaccatcgacgtgttccagcagcagacgggaggtgtgccggagagcagcctggcaggg
cacagtttctag

KEGG   Homo sapiens (human): 6613
Entry
6613              CDS       T01001                                 

Gene name
SUMO2, HSMT3, SMT3B, SMT3H2, SUMO3, Smt3A
Definition
(RefSeq) small ubiquitin like modifier 2
  KO
K12160  small ubiquitin-related modifier
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    6613 (SUMO2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6613 (SUMO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    6613 (SUMO2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    6613 (SUMO2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    6613 (SUMO2)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   6613 (SUMO2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    6613 (SUMO2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    6613 (SUMO2)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin DUF5010_C
Other DBs
NCBI-GeneID: 6613
NCBI-ProteinID: NP_008868
OMIM: 603042
HGNC: 11125
Ensembl: ENSG00000188612
Vega: OTTHUMG00000179481
Pharos: P61956(Tbio)
UniProt: P61956 A0A024R8S3
LinkDB
Structure
PDB: 

Position
17q25.1
AA seq 95 aa
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
NT seq 288 nt   +upstreamnt  +downstreamnt
atggccgacgaaaagcccaaggaaggagtcaagactgagaacaacgatcatattaatttg
aaggtggcggggcaggatggttctgtggtgcagtttaagattaagaggcatacaccactt
agtaaactaatgaaagcctattgtgaacgacagggattgtcaatgaggcagatcagattc
cgatttgacgggcaaccaatcaatgaaacagacacacctgcacagttggaaatggaggat
gaagatacaattgatgtgttccaacagcagacgggaggtgtctactga

KEGG   Homo sapiens (human): 7341
Entry
7341              CDS       T01001                                 

Gene name
SUMO1, DAP1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, UBL1
Definition
(RefSeq) small ubiquitin like modifier 1
  KO
K12160  small ubiquitin-related modifier
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00516  Cleft lip and/or cleft palate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    7341 (SUMO1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    7341 (SUMO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7341 (SUMO1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    7341 (SUMO1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7341 (SUMO1)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   7341 (SUMO1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    7341 (SUMO1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    7341 (SUMO1)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin
Other DBs
NCBI-GeneID: 7341
NCBI-ProteinID: NP_001005781
OMIM: 601912
HGNC: 12502
Ensembl: ENSG00000116030
Vega: OTTHUMG00000132839
Pharos: P63165(Tbio)
UniProt: P63165 A0A024R3Z2
LinkDB
Structure
PDB: 

Position
2q33.1
AA seq 101 aa
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
NT seq 306 nt   +upstreamnt  +downstreamnt
atgtctgaccaggaggcaaaaccttcaactgaggacttgggggataagaaggaaggtgaa
tatattaaactcaaagtcattggacaggatagcagtgagattcacttcaaagtgaaaatg
acaacacatctcaagaaactcaaagaatcatactgtcaaagacagggtgttccaatgaat
tcactcaggtttctctttgagggtcagagaattgctgataatcatactccaaaagaactg
ggaatggaggaagaagatgtgattgaagtttatcaggaacaaacggggggtcattcaaca
gtttag

DBGET integrated database retrieval system