KEGG   Homo sapiens (human): 387893Help
Entry
387893            CDS       T01001                                 

Gene name
KMT5A, PR-Set7, SET07, SET8, SETD8
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    387893 (KMT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    387893 (KMT5A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     387893 (KMT5A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     387893 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 387893
NCBI-ProteinID: NP_065115
OMIM: 607240
HGNC: 29489
Ensembl: ENSG00000183955
Vega: OTTHUMG00000150477
Pharos: Q9NQR1(Tchem)
UniProt: Q9NQR1
LinkDB All DBs
Structure
PDB: 

Position
12q24.31
AA seq 352 aa AA seqDB search
MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSP
NKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDAR
KGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRK
LTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGD
FVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHS
KCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctagaggcaggaagatgtccaagccccgcgcggtggaggcggcggcggcggcggcg
gcggtggcagcgacggccccgggcccggagatggtggagcggaggggcccggggaggccc
cgcaccgacggggagaacgtatttaccgggcagtcaaagatctattcctacatgagcccg
aacaaatgctctggaatgcgtttcccccttcaggaagagaactcagttacacatcacgaa
gtcaaatgccaggggaaaccattagccggaatctacaggaaacgagaagagaaaagaaat
gctgggaacgcagtacggagcgccatgaagtccgaggaacagaagatcaaagacgccagg
aaaggtcccctggtaccttttccaaaccaaaaatctgaagcagcagaacctccaaaaact
ccaccctcatcttgtgattccaccaatgcagccatcgccaagcaagccctgaaaaagccc
atcaagggcaaacaggccccccgaaaaaaagctcaaggaaaaacgcaacagaatcgcaaa
cttacggatttctaccctgtccgaaggagctccaggaagagcaaagccgagctgcagtct
gaagaaaggaaaagaatagatgaattgattgaaagtgggaaggaagaaggaatgaagatt
gacctcatcgatggcaaaggcaggggtgtgattgccaccaagcagttctcccggggtgac
tttgtggtggaataccacggggacctcatcgagatcaccgacgccaagaaacgggaggct
ctgtacgcacaggacccttccacgggctgctacatgtactattttcagtatctgagcaaa
acctactgcgtggatgcaactagagagacaaatcgcctaggaagactgatcaatcacagc
aaatgtgggaactgccaaaccaaactgcacgacatcgacggcgtacctcacctcatcctc
atcgcctcccgagacatcgcggctggggaggagctcctgtatgactatggggaccgcagc
aaggcttccattgaagcccacccgtggctgaagcattaa

DBGET integrated database retrieval system