KEGG   Homo sapiens (human): 388372Help
Entry
388372            CDS       T01001                                 

Gene name
CCL4L1, AT744.2, CCL4L, LAG-1, LAG1, MIP-1-beta, SCYA4L, SCYA4L1, SCYA4L2
Definition
(RefSeq) C-C motif chemokine ligand 4 like 1
  KO
K12964  C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05132  Salmonella infection
hsa05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    388372 (CCL4L1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    388372 (CCL4L1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    388372 (CCL4L1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    388372 (CCL4L1)
   04623 Cytosolic DNA-sensing pathway
    388372 (CCL4L1)
   04062 Chemokine signaling pathway
    388372 (CCL4L1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    388372 (CCL4L1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    388372 (CCL4L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    388372 (CCL4L1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   388372 (CCL4L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 388372
NCBI-ProteinID: NP_996890
OMIM: 603782
HGNC: 10631
UniProt: Q8NHW4 P13236 B7ZW36
LinkDB All DBs
Position
17q12
AA seq 92 aa AA seqDB search
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRGKQVCADPSESWVQEYVYDLELN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcgtgctagtagctgccttctgctctcta
gcactctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaggcaagcaagtctgcgctgaccccagtgagtcc
tgggtccaggagtacgtgtatgacctggaactgaactga

DBGET integrated database retrieval system