KEGG   Homo sapiens (human): 3887Help
Entry
3887              CDS       T01001                                 

Gene name
KRT81, HB1, Hb-1, KRTHB1, MLN137, ghHkb1, hHAKB2-1
Definition
(RefSeq) keratin 81
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00670  Monilethrix
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3887 (KRT81)
   04147 Exosome [BR:hsa04147]
    3887 (KRT81)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3887 (KRT81)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3887 (KRT81)
  Exosomal proteins of other body fluids (saliva and urine)
   3887 (KRT81)
  Exosomal proteins of colorectal cancer cells
   3887 (KRT81)
  Exosomal proteins of bladder cancer cells
   3887 (KRT81)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 DUF4924 CALCOCO1 DHR10 DUF885 Spc7 Tropomyosin_1 SPATA1_C BAT Spc42p
Motif
Other DBs
NCBI-GeneID: 3887
NCBI-ProteinID: NP_002272
OMIM: 602153
HGNC: 6458
Ensembl: ENSG00000205426
Vega: OTTHUMG00000167574
Pharos: Q14533(Tbio)
UniProt: Q14533
LinkDB All DBs
Position
12q13.13
AA seq 505 aa AA seqDB search
MTCGSGFGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCG
RSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF
IDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASEL
NHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLR
RLYEEEILILQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAA
LSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
IGAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNVAVSTGLCAPCGQLNTTCGG
GSCGVGSCGISSLGVGSCGSSCRKC
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacctgcggatcaggatttggtgggcgcgccttcagctgcatctcggcctgcgggccg
cggcccggccgctgctgcatcaccgccgccccctaccgtggcatctcctgctaccgcggc
ctcaccgggggcttcggcagccacagcgtgtgcggaggctttcgggccggctcctgcgga
cgcagcttcggctaccgctccgggggcgtgtgcgggcccagtcccccatgcatcaccacc
gtgtcggtcaacgagagcctcctcacgcccctcaacctggagatcgaccccaacgcgcag
tgcgtgaagcaggaggagaaggagcagatcaagtccctcaacagcaggttcgcggccttc
atcgacaaggtgcgcttcctggagcagcagaacaaactgctggagacaaagctgcagttc
taccagaaccgcgagtgttgccagagcaacctggagcccctgtttgagggctacatcgag
actctgcggcgggaggccgagtgcgtggaggccgacagcgggaggctggcctcagagctt
aaccacgtgcaggaggtgctggagggctacaagaagaagtatgaggaggaggtttctctg
agagcaacagctgagaacgagtttgtggctctgaagaaggatgtggactgcgcctacctc
cgcaagtcagacctggaggccaacgtggaggccctgatccaggagatcgacttcctgagg
cggctgtatgaggaggagatcctcattctccagtcgcacatctcagacacctccgtggtt
gtcaagctggacaacagccgggacctgaacatggactgcatcattgccgagattaaggca
cagtatgacgacattgtcacccgcagccgggccgaggccgagtcctggtaccgcagcaag
tgtgaggagatgaaggccacggtgatcaggcacggggagaccctgcgccgcaccaaggag
gagatcaatgagctgaaccgcatgatccaaaggctgacggccgaggtggagaatgccaag
tgccagaactccaagctggaggccgcggtggcccagtctgagcagcagggtgaggcggcc
ctcagtgatgcccgctgcaagctggccgagctggagggcgccctgcagaaggccaagcag
gacatggcctgcctgatcagggagtaccaggaggtgatgaactccaagctgggcctggac
atcgagatcgccacctacaggcgcctgctggagggcgaggagcagaggctatgtgaaggc
attggggctgtgaatgtctgtgtcagcagctcccggggcggggtcgtgtgcggggacctc
tgcgtgtcaggctcccggccagtgactggcagtgtctgcagcgctccgtgcaacgggaac
gtggcggtgagcaccggcctgtgtgcgccctgcggccaattgaacaccacctgcggaggg
ggttcctgcggcgtgggctcctgtggtatcagctccctgggtgtggggtcttgcggcagc
agctgccggaaatgttag

DBGET integrated database retrieval system