KEGG   Homo sapiens (human): 389206Help
Entry
389206            CDS       T01001                                 

Gene name
BEND4, CCDC4
Definition
(RefSeq) BEN domain containing 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: BEN bZIP_1 Shugoshin_N DUF4686 bZIP_2 NYD-SP28_assoc Uds1
Motif
Other DBs
NCBI-GeneID: 389206
NCBI-ProteinID: NP_997289
HGNC: 23815
Ensembl: ENSG00000188848
Vega: OTTHUMG00000160531
Pharos: Q6ZU67(Tdark)
UniProt: Q6ZU67
LinkDB All DBs
Position
4p13
AA seq 534 aa AA seqDB search
MEEEMQPAEEGPSVPKIYKQRSPYSVLKTFPSKRPALAKRYERPTLVELPHVRAPPPPPP
PFAPHAAVSISSSEPPPQQFQAQSSYPPGPGRAAAAASSSSPSCTPATSQGHLRTPAQPP
PASPAASSSSSFAAVVRYGPGAAAAAGTGGTGSDSASLELSAESRMILDAFAQQCSRVLS
LLNCGGKLLDSNHSQSMISCVKQEGSSYNERQEHCHIGKGVHSQTSDNVDIEMQYMQRKQ
QTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSE
SHGHPSSSTLPEEEEEEDEEGYCPRCQELEQEVISLQQENEELRRKLESIPVPCQTVLDY
LKMVLQHHNQLLIPQPADQPTEGSKQLLNNYPVYITSKQWDEAVNSSKKDGRRLLRYLIR
FVFTTDELKYSCGLGKRKRSVQSGETGPERRPLDPVKVTCLREFIRMHCTSNPDWWMPSE
EQINKVFSDAVGHARQGRAVGTFLHNGGSFYEGIDHQASQDEVFNKSSQDGSGD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagatgcagccggcagaggaggggcccagcgtccccaaaatctacaagcag
cgcagcccctacagcgtcctcaagacgttccccagcaagagaccggcgctggccaagcgc
tacgagcgacccaccctggtggagctgccgcacgtgcgggcgcccccgccgcccccgccg
cccttcgcgccgcacgccgccgtctccatcagcagcagcgagccgccgccgcagcagttc
caggcgcagagctcctacccccccgggcccggccgggccgccgccgccgcttcgtcgtcg
tcgccgtcctgcacgcccgccacatcccagggccacttgaggactccggcgcagccgccg
cccgcgtcccccgccgcctcctcgtcgtcttcgttcgccgctgtcgtcaggtatggccca
ggcgcggcggcggccgccggcaccggcggcacgggtagcgacagcgccagcctggagctc
agcgcagagagtcgaatgatcttggatgcctttgcccagcagtgcagtcgagttcttagc
ctcttaaattgtggaggaaaactcctggactccaaccattctcagtccatgatttcttgc
gtaaagcaggaaggctcaagttacaacgaaagacaggagcactgtcacattgggaaaggg
gtccacagtcagacctcagacaatgtagacatagagatgcagtatatgcaaaggaaacaa
caaacttctgcctttttgagggttttcactgactctctacaaaattacctgctctcggga
agctttccaactccaaacccctcgtcagccagtgaatatggccatctggccgacgtggat
cctctgtcaacctctcctgtgcatacattaggtggctggacttccccagcaacgtccgaa
tcccatggccacccatcttcatctacactgccagaagaggaggaggaggaggacgaggaa
ggctattgtcctcgatgccaagagctggagcaggaggttatttcactgcaacaagaaaat
gaagagctcagaaggaaattagagagcatcccagtgccctgccagaccgttttagattac
ttgaagatggttctgcagcaccacaaccaactcctgataccacagccagctgaccagccg
acagagggaagcaagcagctgttgaacaactatcctgtctacataacgagcaaacagtgg
gatgaggctgtaaattcttcaaagaaagatgggagacggctccttcgatacctcatcaga
tttgttttcacaaccgatgagcttaagtactcatgcggccttgggaaaaggaaaaggtca
gtgcagtcaggagagacaggtcccgaaagacgccctctggatccagttaaagtaacatgc
ctccgagaattcattaggatgcattgtacctccaaccccgattggtggatgccctcggaa
gagcagataaacaaagtgttcagcgacgctgtcggtcacgcccgacaggggcgggcggtg
gggactttcctgcacaacggtggctcattttatgaagggatcgatcaccaggcttctcag
gatgaagtcttcaataaaagttcccaggatggatctggggattag

DBGET integrated database retrieval system