KEGG   Homo sapiens (human): 389434
Entry
389434            CDS       T01001                                 

Gene name
IYD, C6orf71, DEHAL1, IYD-1, TDH4
Definition
(RefSeq) iodotyrosine deiodinase
  KO
K17231  iodotyrosine deiodinase [EC:1.21.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04918  Thyroid hormone synthesis
Network
nt06322  TRH-TSH-TH signaling
  Element
N00791  Deiodination of MIT and DIT
N00792  Mutation-inactivated IYD to deiodination of MIT and DIT
Disease
H00251  Thyroid dyshormonogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    389434 (IYD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.1  
    1.21.1.1  iodotyrosine deiodinase
     389434 (IYD)
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase FAM176
Other DBs
NCBI-GeneID: 389434
NCBI-ProteinID: NP_981932
OMIM: 612025
HGNC: 21071
Ensembl: ENSG00000009765
Vega: OTTHUMG00000016347
Pharos: Q6PHW0(Tbio)
UniProt: Q6PHW0
LinkDB
Structure
PDB: 
5YAK 4TTB 4TTC

Position
6q25.1
AA seq 289 aa
MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEED
ADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVI
RTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNW
IKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTP
LNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV
NT seq 870 nt   +upstreamnt  +downstreamnt
atgtatttcctgactcccatcttggtagccattctctgcattttggttgtgtggatcttt
aaaaatgccgacagaagcatggagaaaaagaagggggagcctagaaccagggccgaagct
cgcccctgggtggatgaagacttaaaagacagcagtgacctgcaccaagcagaagaagat
gctgatgaatggcaagaatcagaagaaaatgttgaacacatccccttctctcataaccac
tatcctgagaaggaaatggttaagaggtctcaggaattttatgaacttctcaataagaga
cggtcagtcaggttcataagtaatgagcaagtcccaatggaagtcattgataatgtcatc
agaacggcaggaacagccccgagtggggctcacacagagccctggaccttcgtggttgtg
aaggacccagacgtgaagcacaagattcgaaagatcattgaggaggaagaggagatcaac
tacatgaaaaggatgggacatcgctgggtcacagacctcaagaaactgagaaccaactgg
attaaagagtacttggatactgcccctattttgattctcattttcaaacaagtacatggt
ttcgccgcaaatggcaagaaaaaagtccactactacaatgagatcagtgtttccatcgct
tgtggcatcctgctagctgccctgcagaatgcaggtctggtgactgtcactaccactcct
ctcaactgtggccctcgactgagggtgctcctgggccgccccgcacatgaaaagctgctg
atgctgctccccgtggggtaccccagcaaggaggccacggtgcctgacctcaagcgcaaa
cctctggaccagatcatggtgacagtgtag

DBGET integrated database retrieval system