KEGG   Homo sapiens (human): 390212Help
Entry
390212            CDS       T01001                                 

Gene name
GPR152, PGR5
Definition
(RefSeq) G protein-coupled receptor 152
  KO
K08436  G protein-coupled receptor 152
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    390212 (GPR152)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    390212 (GPR152)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 390212
NCBI-ProteinID: NP_996880
HGNC: 23622
Ensembl: ENSG00000175514
Vega: OTTHUMG00000168032
Pharos: Q8TDT2(Tbio)
UniProt: Q8TDT2 A0A0I9RJ67
LinkDB All DBs
Position
11q13.2
AA seq 470 aa AA seqDB search
MDTTMEADLGATGHRPRTELDDEDSYPQGGWDTVFLVALLLLGLPANGLMAWLAGSQARH
GAGTRLALLLLSLALSDFLFLAAAAFQILEIRHGGHWPLGTAACRFYYFLWGVSYSSGLF
LLAALSLDRCLLALCPHWYPGHRPVRLPLWVCAGVWVLATLFSVPWLVFPEAAVWWYDLV
ICLDFWDSEELSLRMLEVLGGFLPFLLLLVCHVLTQATACRTCHRQQQPAACRGFARVAR
TILSAYVVLRLPYQLAQLLYLAFLWDVYSGYLLWEALVYSDYLILLNSCLSPFLCLMASA
DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQV
NPTLQPRSDPTAQPQLNPTAQPQSDPTAQPQLNLMAQPQSDSVAQPQADTNVQTPAPAAS
SVPSPCDEASPTPSSHPTPGALEDPATPPASEGESPSSTPPEAAPGAGPT
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggacactaccatggaagctgacctgggtgccactggccacaggccccgcacagagctt
gatgatgaggactcctacccccaaggtggctgggacacggtcttcctggtggccctgctg
ctccttgggctgccagccaatgggttgatggcgtggctggccggctcccaggcccggcat
ggagctggcacgcgtctggcgctgctcctgctcagcctggccctctctgacttcttgttc
ctggcagcagcggccttccagatcctagagatccggcatgggggacactggccgctgggg
acagctgcctgccgcttctactacttcctatggggcgtgtcctactcctccggcctcttc
ctgctggccgccctcagcctcgaccgctgcctgctggcgctgtgcccacactggtaccct
gggcaccgcccagtccgcctgcccctctgggtctgcgccggtgtctgggtgctggccaca
ctcttcagcgtgccctggctggtcttccccgaggctgccgtctggtggtacgacctggtc
atctgcctggacttctgggacagcgaggagctgtcgctgaggatgctggaggtcctgggg
ggcttcctgcctttcctcctgctgctcgtctgccacgtgctcacccaggccacagcctgt
cgcacctgccaccgccaacagcagcccgcagcctgccggggcttcgcccgtgtggccagg
accattctgtcagcctatgtggtcctgaggctgccctaccagctggcccagctgctctac
ctggccttcctgtgggacgtctactctggctacctgctctgggaggccctggtctactcc
gactacctgatcctactcaacagctgcctcagccccttcctctgcctcatggccagtgcc
gacctccggaccctgctgcgctccgtgctctcgtccttcgcggcagctctctgcgaggag
cggccgggcagcttcacgcccactgagccacagacccagctagattctgagggtccaact
ctgccagagccgatggcagaggcccagtcacagatggatcctgtggcccagcctcaggtg
aaccccacactccagccacgatcggatcccacagctcagccacagctgaaccctacggcc
cagccacagtcggatcccacagcccagccacagctgaacctcatggcccagccacagtca
gattctgtggcccagccacaggcagacactaacgtccagacccctgcacctgctgccagt
tctgtgcccagtccctgtgatgaagcttccccaaccccatcctcgcatcctaccccaggg
gcccttgaggacccagccacacctcctgcctctgaaggagaaagccccagcagcaccccg
ccagaggcggccccgggcgcaggccccacgtga

DBGET integrated database retrieval system