KEGG   Homo sapiens (human): 390916
Entry
390916            CDS       T01001                                 

Gene name
NUDT19, RP2
Definition
(RefSeq) nudix hydrolase 19
  KO
K13355  nucleoside diphosphate-linked moiety X motif 19, mitochondrial [EC:3.6.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    390916 (NUDT19)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     390916 (NUDT19)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 390916
NCBI-ProteinID: NP_001099040
HGNC: 32036
Ensembl: ENSG00000213965
Vega: OTTHUMG00000180228
Pharos: A8MXV4(Tdark)
UniProt: A8MXV4
LinkDB
Position
19q13.11
AA seq 375 aa
MSSSLRPGPSRWRRAASIVLAAGWSRPETATPPSRPPPAEGFRLLLLQRSPHQGFMPGAH
VFSGGVLDAADRSADWLGLFAPHHGPPRFGLGPAPFSRTAFPSLPDTDDHKTDNTGTLPE
DVAFRICAVREAFEEAGVLLLRPRTSPPGPAPGPGLALEPPPGLASWRDRVRQDPRHFLR
LCAHLDCTPDIWALHNWSAWLTPFLRGTTRRFDTAFFLCCLREPPPVYPDLAEVVGYQWS
SPSEATESFLSKEIWLPPPQFYEVRRLANFASLSDLHKFCLGRALEGLERWLPIILLTAD
GMVHLLPGDELYLEDSDFLENLMSTEKKTEEIMKEGKQFHRIVTYHRHLYDIHVTVQPKY
KHVYPKNSVVRKSHL
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagcagctccctgcggccgggccccagccgctggcggcgggcggccagcatcgtcctg
gcggctggctggtcgcgcccggagaccgccaccccgccgtcgcgcccgccgccggccgag
ggcttccggctgctgctgctgcagcgctccccgcaccaaggcttcatgccgggcgcgcac
gtcttctccggcggagtgctggatgcggccgaccgctcggcggactggctgggcctcttc
gcgccgcaccacgggccgccgcgcttcggcctgggcccggcgccattcagccgcaccgct
ttcccgtcgctgcccgacaccgatgaccacaagaccgacaacactgggacgctgcctgag
gacgtagccttccgcatctgcgccgtgcgggaggcctttgaggaggcgggcgtgctgctg
ctgcggcccaggacttccccaccaggcccagcacccgggcctggcctcgccctggagcca
ccgccgggcctggcctcctggcgcgaccgcgtgcgccaggacccgcgccacttcctgcgg
ctgtgcgcccacctcgactgcacacccgacatctgggcgctgcacaactggagcgcctgg
ctcacccctttcttgcggggcaccactcgccgctttgacacggccttcttcctgtgctgc
ctgcgcgagccgccgcccgtctaccccgacttggcggaggtggtgggctaccagtggtca
tctccatcagaggcaactgaaagtttcttatcaaaagaaatttggttgccacccccacag
ttctacgaagtgagaagacttgcaaactttgcctctctctctgacttgcacaaattttgt
ttgggtcgtgcattagaaggactggaaaggtggctgccgatcatcttgttaactgctgat
gggatggtccatcttttaccaggtgatgagctatatttagaagattcagactttttggaa
aatcttatgtctactgaaaaaaagactgaggaaatcatgaaggaaggcaagcagtttcac
cggatagtgacataccatcgccacctttatgatatccacgtgactgttcagccaaagtat
aaacacgtttatcctaagaactctgtagtaagaaaaagccatttgtag

DBGET integrated database retrieval system