KEGG   Homo sapiens (human): 3910Help
Entry
3910              CDS       T01001                                 

Gene name
LAMA4, CMD1JJ, LAMA3, LAMA4*-1
Definition
(RefSeq) laminin subunit alpha 4
  KO
K06241  laminin, alpha 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05143  African trypanosomiasis
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3910 (LAMA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3910 (LAMA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3910 (LAMA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3910 (LAMA4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3910 (LAMA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3910 (LAMA4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3910 (LAMA4)
   05145 Toxoplasmosis
    3910 (LAMA4)
   05143 African trypanosomiasis
    3910 (LAMA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_EGF Laminin_G_3 Focal_AT
Motif
Other DBs
NCBI-GeneID: 3910
NCBI-ProteinID: NP_001098676
OMIM: 600133
HGNC: 6484
Ensembl: ENSG00000112769
Vega: OTTHUMG00000015386
Pharos: Q16363(Tbio)
UniProt: Q16363 A0A0A0MQS9
LinkDB All DBs
Position
6q21
AA seq 1823 aa AA seqDB search
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDLTDDLRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKE
NQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNYVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADS
LTTPRLTLSELDDIIKNASGIYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIVNYVSEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVNS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITRRGKFGQVTRFDIEVR
TPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWD
PVALKLPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA
NT seq 5472 nt NT seq  +upstreamnt  +downstreamnt
atggctttgagctcagcctggcgctcggttctgcctctgtggctcctctggagcgctgcc
tgctcccgcgccgcgtccggggacgacaacgcttttccttttgacattgaagggagctca
gcggttggcaggcaagacccgcctgagacgagcgaaccccgcgtggctctgggacgcctg
ccgcctgcggccgagaaatgcaatgctggattctttcacaccctgtcgggagaatgtgtg
ccctgcgactgtaatggcaattccaacgagtgtttggacggctcaggatactgtgtgcac
tgccagcggaacacaacaggagagcactgtgaaaagtgtctggatggttatatcggagat
tccatcaggggagcaccccaattctgccagccgtgcccctgtcccctgccccacttggcc
aattttgcagaatcctgctataggaaaaatggagctgttcggtgcatttgtaacgaaaat
tatgctggacctaactgtgaaagatgtgctcccggttactatggaaaccccttactcatt
ggaagcacctgtaagaaatgtgactgcagtggaaattcagatcccaacctgatctttgaa
gattgtgatgaagtcactggccagtgtaggaattgcttacgcaacaccaccggattcaag
tgtgaacgttgcgctcctggctactatggggacgccaggatagccaagaactgtgcagtg
tgcaactgcgggggaggcccatgtgacagtgtaaccggagaatgcttggaagaaggtttt
gaaccccctacaggcatggactgcccaaccataagctgtgataagtgcgtctgggacctg
actgatgacctgcggttagcagcgctctccatcgaggaaggcaaatccggggtgctgagc
gtatcctctggggccgccgctcataggcacgtgaatgaaatcaacgccaccatctacctc
ctcaaaacaaaattgtcagaaagagaaaaccaatacgccctaagaaagatacaaatcaac
aatgctgagaacacgatgaaaagccttctgtctgacgtagaggaattagttgaaaaggaa
aatcaagcctccagaaaaggacaacttgttcagaaggaaagcatggacaccattaaccac
gcaagtcagctggtagagcaagcccatgatatgagggataaaatccaagagatcaacaac
aagatgctctattatggggaagagcatgaacttagccccaaggaaatctctgagaagctg
gtgttggcccagaagatgcttgaagagattagaagccgtcaaccatttttcacccaacgg
gagctcgtggatgaggaggcagatgaggcttacgaactactgagccaggctgagagctgg
cagcggctgcacaatgagacccgcactctgtttcctgtcgtcctggagcagctggatgac
tacaatgctaagttgtcagatctccaggaagcacttgaccaggcccttaactatgtcagg
gatgccgaagacatgaacagggccacagcagccaggcagcgggaccatgagaaacaacag
gaaagagtgagggaacaaatggaagtggtgaacatgtctctgagcacatctgcggactct
ctgacaacacctcgtctaactctttcagaacttgatgatataataaagaatgcgtcaggg
atttatgcagaaatagatggagccaaaagtgaactacaagtaaaactatctaacctaagt
aacctcagccatgatttagtccaagaagctattgaccatgcacaggaccttcaacaagaa
gctaatgaattgagcaggaagttgcacagttcagatatgaacgggctggtacagaaggct
ttggatgcatcaaatgtctatgaaaatattgttaattatgttagtgaagccaatgaaaca
gcagaatttgctttgaacaccactgaccgaatttatgatgcggtgagtgggattgatact
caaatcatttaccataaagatgaaagtgagaacctcctcaatcaagccagagaactgcaa
gcaaaggcagagtctagcagtgatgaagcagtggctgacactagcaggcgtgtgggtgga
gccctagcaaggaaaagtgcccttaaaaccagactcagtgatgccgttaagcaactacaa
gcagcagagagaggggatgcccagcagcgcctggggcagtctagactgatcaccgaggaa
gccaacaggacgacgatggaggtgcagcaggccactgcccccatggccaacaatctaacc
aactggtcacagaatcttcaacattttgactcttctgcttacaacactgcagtgaactct
gctagggatgcagtaagaaatctgaccgaggttgtccctcagctcctggatcagcttcgt
acggttgagcagaagcgacctgcaagcaacgtttctgccagcatccagaggatccgagag
ctcattgctcagaccagaagtgttgccagcaagatccaagtctccatgatgtttgatggc
cagtcagctgtggaagtgcactcgagaaccagtatggatgacttaaaggccttcacgtct
ctgagcctgtacatgaaaccccctgtgaagcggccggaactgaccgagactgcagatcag
tttatcctgtacctcggaagcaaaaacgccaaaaaagagtatatgggtcttgcaatcaaa
aatgataatctggtatacgtctataatttgggaactaaagatgtggagattcccctggac
tccaagcccgtcagttcctggcctgcttacttcagcattgtcaagattgaaagggtggga
aaacatggaaaggtgtttttaacagtcccgagtctaagtagcacagcagaggaaaagttc
attaaaaagggggaattttcgggagatgactctctgctggacctggaccctgaggacaca
gtgttttatgttggtggagtgccttccaacttcaagctccctaccagcttaaacctgcct
ggctttgttggctgcctggaactggccactttgaataatgatgtgatcagcttgtacaac
tttaagcacatctataatatggacccctccacatcagtgccatgtgcccgagataagctg
gccttcactcagagtcgggctgccagttacttcttcgatggctccggttatgccgtggtg
agagacatcacaaggagagggaaatttggtcaggtgactcgctttgacatagaagttcga
acaccagctgacaacggccttattctcctgatggtcaatggaagtatgtttttcagactg
gaaatgcgcaatggttacctacatgtgttctatgattttggattcagcggtggccctgtg
catcttgaagatacgttaaagaaagctcaaattaatgatgcaaaataccatgagatctca
atcatttaccacaatgataagaaaatgatcttggtagttgacagaaggcatgtcaagagc
atggataatgaaaagatgaaaataccttttacagatatatacattggaggagctcctcca
gaaatcttacaatccagggccctcagagcacaccttcccctagatatcaacttcagagga
tgcatgaagggcttccagttccaaaagaaggacttcaatttactggagcagacagaaacc
ctgggagttggttatggatgcccagaagactcacttatatctcgcagagcatatttcaat
ggacagagcttcattgcttcaattcagaaaatatctttctttgatggctttgaaggaggt
tttaatttccgaacattacaaccaaatgggttactattctattatgcttcagggtcagac
gtgttctccatctcactggataatggtactgtcatcatggatgtaaagggaatcaaagtt
cagtcagtagataagcagtacaatgatgggctgtcccacttcgtcattagctctgtctca
cccacaagatatgaactgatagtagataaaagcagagttgggagtaagaatcctaccaaa
gggaaaatagaacagacacaagcaagtgaaaagaagttttacttcggtggctcaccaatc
agtgctcagtatgctaatttcactggctgcataagtaatgcctactttaccagggtggat
agagatgtggaggttgaagatttccaacggtatactgaaaaggtccacacttctctttat
gagtgtcccattgagtcttcaccattgtttctcctccataaaaaaggaaaaaatttatcc
aagcctaaagcaagtcagaataaaaagggagggaaaagtaaagatgcaccttcatgggat
cctgttgctctgaaactcccagagcggaatactccaagaaactctcattgccacctttcc
aacagccctagagcaatagagcacgcctatcaatatggaggaacagccaacagccgccaa
gagtttgaacacttaaaaggagattttggtgccaaatctcagttttccattcgtctgaga
actcgttcctcccatggcatgatcttctatgtctcagatcaagaagagaatgacttcatg
actctatttttggcccatggccgcttggtttacatgtttaatgttggtcacaaaaaactg
aagattagaagccaggagaaatacaatgatggcctgtggcatgatgtgatatttattcga
gaaaggagcagtggccgactggtaattgatggtctccgagtcctagaagaaagtcttcct
cctactgaagctacctggaaaatcaagggtcccatttatttgggaggtgtggctcctgga
aaggctgtgaaaaatgttcagattaactccatctacagttttagtggctgtctcagcaat
ctccagctcaatggggcctccatcacctctgcttctcagacattcagtgtgaccccttgc
tttgaaggccccatggaaacaggaacttacttttcaacagaaggaggatacgtggttcta
gatgaatctttcaatattggattgaagtttgaaattgcatttgaagtccgtcccagaagc
agttccggaaccctggtccacggccacagtgtcaatggggagtacctaaatgttcacatg
aaaaatggacaggtcatagtgaaagtcaataatggcatcagagatttttccacctcagtt
acacccaagcagagtctctgtgatggcagatggcacagaattacagttattagagattct
aatgtggttcagttggatgtggactctgaagtgaaccatgtggttggacccctgaatcca
aaaccaattgatcacagggagcctgtgtttgttggaggtgttccagaatctctactgaca
ccacgcttggcccccagcaaacccttcacaggctgcatacgccactttgtgattgatgga
cacccagtgagcttcagtaaagcagccctggtcagcggcgccgtaagcatcaactcctgt
ccagcagcctga

DBGET integrated database retrieval system