KEGG   Homo sapiens (human): 3915Help
Entry
3915              CDS       T01001                                 

Gene name
LAMC1, LAMB2
Definition
(RefSeq) laminin subunit gamma 1
  KO
K05635  laminin, gamma 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05020  Prion diseases
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3915 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3915 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3915 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3915 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3915 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    3915 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3915 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3915 (LAMC1)
   05145 Toxoplasmosis
    3915 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 3915
NCBI-ProteinID: NP_002284
OMIM: 150290
HGNC: 6492
Ensembl: ENSG00000135862
Vega: OTTHUMG00000035418
Pharos: P11047(Tbio)
UniProt: P11047 Q6NVY8
LinkDB All DBs
Structure
PDB: 

Position
1q25.3
AA seq 1609 aa AA seqDB search
MRGSHRAAPALRPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFN
VTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQS
QTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSG
SCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVL
QEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEF
DKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRS
TGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSSCHCSPVGSLSTQCDSYGRCSCKP
GVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNIETGRCVCKDNVEGFNCERCKPG
FFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRAEQRDGSEASLEW
SSERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGA
GLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTY
SERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSP
CVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSS
CAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVG
NCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNP
VTGQCECLPHVTGQDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGI
TGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYF
YNRSWPGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAER
EVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVEN
TERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRV
AKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRA
GDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEQLIDQKLKDYEDLREDMRGKELE
VKNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDN
KTAAEEALRKIPAINQTITEANEKTREAQQALGSAAADATEAKNKAHEAERIASAVQKNA
TSTKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAE
INARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSD
LENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
NT seq 4830 nt NT seq  +upstreamnt  +downstreamnt
atgagagggagccatcgggccgcgccggccctgcggccccgggggcggctctggcccgtg
ctggccgtgctggcggcggccgccgcggcgggctgtgcccaggcagccatggacgagtgc
acggacgagggcgggcggccgcagcgctgcatgcccgagttcgtcaacgccgccttcaac
gtgactgtggtggccaccaacacgtgtgggactccgcccgaggaatactgtgtgcagacc
ggggtgaccggggtcaccaagtcctgtcacctgtgcgacgccgggcagccccacctgcag
cacggggcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagc
cagaccatgctggccggggtgcagtaccccagctccatcaacctcacgctgcacctggga
aaagcttttgacatcacctatgtgcgtctcaagttccacaccagccgcccggagagcttt
gccatttacaagcgcacacgggaagacgggccctggattccttaccagtactacagtggt
tcctgtgagaacacctactccaaggcaaaccgcggcttcatcaggacaggaggggacgag
cagcaggccttgtgtactgatgaattcagtgacatttctcccctcactgggggcaacgtg
gccttttctaccctggaaggaaggcccagcgcctataactttgacaatagccctgtgctg
caggaatgggtaactgccactgacatcagagtaactcttaatcgcctgaacacttttgga
gatgaagtgtttaacgatcccaaagttctcaagtcctattattatgccatctctgatttt
gctgtaggtggcagatgtaaatgtaatggacacgcaagcgagtgtatgaagaacgaattt
gataagctggtgtgtaattgcaaacataacacatatggagtagactgtgaaaagtgtctt
cctttcttcaatgaccggccgtggaggagggcaactgcggaaagtgccagtgaatgcctg
ccctgtgattgcaatggtcgatcccaggaatgctacttcgaccctgaactctatcgttcc
actggccatgggggccactgtaccaactgccaggataacacagatggcgcccactgtgag
aggtgccgagagaacttcttccgccttggcaacaatgaagcctgctcttcatgccactgt
agtcctgtgggctctctaagcacacagtgtgatagttacggcagatgcagctgtaagcca
ggagtgatgggggacaaatgtgaccgttgccagcctggattccattctctcactgaagca
ggatgcaggccatgctcttgtgatccctctggcagcatagatgaatgtaatattgaaaca
ggaagatgtgtttgcaaagacaatgtcgaaggcttcaattgtgaaagatgcaaacctgga
ttttttaatctggaatcatctaatcctcggggttgcacaccctgcttctgctttgggcat
tcttctgtctgtacaaacgctgttggctacagtgtttattctatctcctctacctttcag
attgatgaggatgggtggcgtgcggaacagagagatggctctgaagcatctctcgagtgg
tcctctgagaggcaagatatcgccgtgatctcagacagctactttcctcggtacttcatt
gctcctgcaaagttcttgggcaagcaggtgttgagttatggtcagaacctctccttctcc
tttcgagtggacaggcgagatactcgcctctctgcagaagaccttgtgcttgagggagct
ggcttaagagtatctgtacccttgatcgctcagggcaattcctatccaagtgagaccact
gtgaagtatgtcttcaggctccatgaagcaacagattacccttggaggcctgctcttacc
ccttttgaatttcagaagctcctaaacaacttgacctctatcaagatacgtgggacatac
agtgagagaagtgctggatatttggatgatgtcaccctggcaagtgctcgtcctgggcct
ggagtccctgcaacttgggtggagtcctgcacctgtcctgtgggatatggagggcagttt
tgtgagatgtgcctctcaggttacagaagagaaactcctaatcttggaccatacagtcca
tgtgtgctttgcgcctgcaatggacacagcgagacctgtgatcctgagacaggtgtttgt
aactgcagagacaatacggctggcccgcactgtgagaagtgcagtgatgggtactatgga
gattcaactgcaggcacctcctccgattgccaaccctgtccgtgtcctggaggttcaagt
tgtgctgttgttcccaagacaaaggaggtggtgtgcaccaactgtcctactggcaccact
ggtaagagatgtgagctctgtgatgatggctactttggagaccccctgggtagaaacggc
cctgtgagactttgccgcctgtgccagtgcagtgacaacatcgatcccaatgcagttgga
aattgcaatcgcttgacgggagaatgcctgaagtgcatctataacactgctggcttctat
tgtgaccggtgcaaagacggattttttggaaatcccctggctcccaatccagcagacaaa
tgcaaagcctgcaattgcaatctgtatgggaccatgaagcagcagagcagctgtaacccc
gtgacggggcagtgtgaatgtttgcctcacgtgactggccaggactgtggtgcttgtgac
cctggattctacaatctgcagagtgggcaaggctgtgagaggtgtgactgccatgccttg
ggctccaccaatgggcagtgtgacatccgcaccggccagtgtgagtgccagcccggcatc
actggtcagcactgtgagcgctgtgaggtcaaccactttgggtttggacctgaaggctgc
aaaccctgtgactgtcatcctgagggatctctttcacttcagtgcaaagatgatggtcgc
tgtgaatgcagagaaggctttgtgggaaatcgctgtgaccagtgtgaagaaaactatttc
tacaatcggtcttggcctggctgccaggaatgtccagcttgttaccggctggtaaaggat
aaggttgctgatcatagagtgaagctccaggaattagagagtctcatagcaaaccttgga
actggggatgagatggtgacagatcaagccttcgaggatagactaaaggaagcagagagg
gaagttatggacctccttcgtgaggcccaggatgtcaaagatgttgaccagaatttgatg
gatcgcctacagagagtgaataacactctgtccagccaaattagccgtttacagaatatc
cggaataccattgaagagactggaaacttggctgaacaagcgcgtgcccatgtagagaac
acagagcggttgattgaaatcgcatccagagaacttgagaaagcaaaagtcgctgctgcc
aatgtgtcagtcactcagccagaatctacaggggacccaaacaacatgactcttttggca
gaagaggctcgaaagcttgctgaacgtcataaacaggaagctgatgacattgttcgagtg
gcaaagacagccaatgatacgtcaactgaggcatacaacctgcttctgaggacactggca
ggagaaaatcaaacagcatttgagattgaagagcttaataggaagtatgaacaagcgaag
aacatctcacaggatctggaaaaacaagctgcccgagtacatgaggaggccaaaagggcc
ggtgacaaagctgtggagatctatgccagcgtggctcagctgagccctttggactctgag
acactggagaatgaagcaaataacataaagatggaagctgagaatctggaacaactgatt
gaccagaaattaaaagattatgaggacctcagagaagatatgagagggaaggaacttgaa
gtcaagaaccttctggagaaaggcaagactgaacagcagaccgcagaccaactcctagcc
cgagctgatgctgccaaggccctcgctgaagaagctgcaaagaagggacgggatacctta
caagaagctaatgacattctcaacaacctgaaagattttgataggcgtgtgaacgataac
aagacggccgcagaggaggcactaaggaagattcctgccatcaaccagaccatcactgaa
gccaatgaaaagaccagagaagcccagcaggccctgggcagtgctgcggcggatgccaca
gaggccaagaacaaggcccatgaggcggagaggatcgcgagcgctgtccaaaagaatgcc
accagcaccaaggcagaagctgaaagaacttttgcagaagttacagatctggataatgag
gtgaacaatatgttgaagcaactgcaggaagcagaaaaagagctaaagagaaaacaagat
gacgctgaccaggacatgatgatggcagggatggcttcacaggctgctcaagaagccgag
atcaatgccagaaaagccaaaaactctgttactagcctcctcagcattattaatgacctc
ttggagcagctggggcagctggatacagtggacctgaataagctaaacgagattgaaggc
accctaaacaaagccaaagatgaaatgaaggtcagcgatcttgataggaaagtgtctgac
ctggagaatgaagccaagaagcaggaggctgccatcatggactataaccgagatatcgag
gagatcatgaaggacattcgcaatctggaggacatcaggaagaccttaccatctggctgc
ttcaacaccccgtccattgaaaagccctag

DBGET integrated database retrieval system