KEGG   Homo sapiens (human): 3916Help
Entry
3916              CDS       T01001                                 

Gene name
LAMP1, CD107a, LAMPA, LGP120
Definition
(RefSeq) lysosomal associated membrane protein 1
  KO
K06528  lysosomal-associated membrane protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04142  Lysosome
hsa04145  Phagosome
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3916 (LAMP1)
   04142 Lysosome
    3916 (LAMP1)
   04140 Autophagy - animal
    3916 (LAMP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3916 (LAMP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3916 (LAMP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3916 (LAMP1)
   04090 CD molecules [BR:hsa04090]
    3916 (LAMP1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Cargo receptors
    3916 (LAMP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   3916 (LAMP1)
CD molecules [BR:hsa04090]
 Proteins
  3916 (LAMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lamp ATP-synt_S1
Motif
Other DBs
NCBI-GeneID: 3916
NCBI-ProteinID: NP_005552
OMIM: 153330
HGNC: 6499
Ensembl: ENSG00000185896
Vega: OTTHUMG00000017380
Pharos: P11279(Tbio)
UniProt: P11279 A0A024RDY3
LinkDB All DBs
Position
13q34
AA seq 417 aa AA seqDB search
MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGP
KNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVY
NLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLS
NSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQL
NLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF
LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQ
AFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccccggcagcgcccggcgacccctgctgctgctactgctgttgctgctgctc
ggcctcatgcattgtgcgtcagcagcaatgtttatggtgaaaaatggcaacgggaccgcg
tgcataatggccaacttctctgctgccttctcagtgaactacgacaccaagagtggccct
aagaacatgacctttgacctgccatcagatgccacagtggtgctcaaccgcagctcctgt
ggaaaagagaacacttctgaccccagtctcgtgattgcttttggaagaggacatacactc
actctcaatttcacgagaaatgcaacacgttacagcgtccagctcatgagttttgtttat
aacttgtcagacacacaccttttccccaatgcgagctccaaagaaatcaagactgtggaa
tctataactgacatcagggcagatatagataaaaaatacagatgtgttagtggcacccag
gtccacatgaacaacgtgaccgtaacgctccatgatgccaccatccaggcgtacctttcc
aacagcagcttcagccggggagagacacgctgtgaacaagacaggccttccccaaccaca
gcgccccctgcgccacccagcccctcgccctcacccgtgcccaagagcccctctgtggac
aagtacaacgtgagcggcaccaacgggacctgcctgctggccagcatggggctgcagctg
aacctcacctatgagaggaaggacaacacgacggtgacaaggcttctcaacatcaacccc
aacaagacctcggccagcgggagctgcggcgcccacctggtgactctggagctgcacagc
gagggcaccaccgtcctgctcttccagttcgggatgaatgcaagttctagccggtttttc
ctacaaggaatccagttgaatacaattcttcctgacgccagagaccctgcctttaaagct
gccaacggctccctgcgagcgctgcaggccacagtcggcaattcctacaagtgcaacgcg
gaggagcacgtccgtgtcacgaaggcgttttcagtcaatatattcaaagtgtgggtccag
gctttcaaggtggaaggtggccagtttggctctgtggaggagtgtctgctggacgagaac
agcatgctgatccccatcgctgtgggtggtgccctggcggggctggtcctcatcgtcctc
atcgcctacctcgtcggcaggaagaggagtcacgcaggctaccagactatctag

KEGG   Homo sapiens (human): 3920Help
Entry
3920              CDS       T01001                                 

Gene name
LAMP2, CD107b, LAMP-2, LAMPB, LGP-96, LGP110
Definition
(RefSeq) lysosomal associated membrane protein 2
  KO
K06528  lysosomal-associated membrane protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04142  Lysosome
hsa04145  Phagosome
hsa05152  Tuberculosis
Disease
H00150  Danon disease
H01781  Autophagic vacuolar myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3920 (LAMP2)
   04142 Lysosome
    3920 (LAMP2)
   04140 Autophagy - animal
    3920 (LAMP2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3920 (LAMP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3920 (LAMP2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3920 (LAMP2)
   04090 CD molecules [BR:hsa04090]
    3920 (LAMP2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Cargo receptors
    3920 (LAMP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   3920 (LAMP2)
CD molecules [BR:hsa04090]
 Proteins
  3920 (LAMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lamp ATP-synt_S1 CTV_P6
Motif
Other DBs
NCBI-GeneID: 3920
NCBI-ProteinID: NP_002285
OMIM: 309060
HGNC: 6501
Ensembl: ENSG00000005893
Vega: OTTHUMG00000022301
Pharos: P13473(Tbio)
UniProt: P13473
LinkDB All DBs
Structure
PDB: 

Position
Xq24
AA seq 410 aa AA seqDB search
MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKT
YKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNT
GDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNG
TVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQ
LNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVN
ISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQG
KYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcttccgcctcttcccggttccgggctcagggctcgttctggtctgcctagtc
ctgggagctgtgcggtcttatgcattggaacttaatttgacagattcagaaaatgccact
tgcctttatgcaaaatggcagatgaatttcacagtacgctatgaaactacaaataaaact
tataaaactgtaaccatttcagaccatggcactgtgacatataatggaagcatttgtggg
gatgatcagaatggtcccaaaatagcagtgcagttcggacctggcttttcctggattgcg
aattttaccaaggcagcatctacttattcaattgacagcgtctcattttcctacaacact
ggtgataacacaacatttcctgatgctgaagataaaggaattcttactgttgatgaactt
ttggccatcagaattccattgaatgacctttttagatgcaatagtttatcaactttggaa
aagaatgatgttgtccaacactactgggatgttcttgtacaagcttttgtccaaaatggc
acagtgagcacaaatgagttcctgtgtgataaagacaaaacttcaacagtggcacccacc
atacacaccactgtgccatctcctactacaacacctactccaaaggaaaaaccagaagct
ggaacctattcagttaataatggcaatgatacttgtctgctggctaccatggggctgcag
ctgaacatcactcaggataaggttgcttcagttattaacatcaaccccaatacaactcac
tccacaggcagctgccgttctcacactgctctacttagactcaatagcagcaccattaag
tatctagactttgtctttgctgtgaaaaatgaaaaccgattttatctgaaggaagtgaac
atcagcatgtatttggttaatggctccgttttcagcattgcaaataacaatctcagctac
tgggatgcccccctgggaagttcttatatgtgcaacaaagagcagactgtttcagtgtct
ggagcatttcagataaatacctttgatctaagggttcagcctttcaatgtgacacaagga
aagtattctacagctcaagactgcagtgcagatgacgacaacttccttgtgcccatagcg
gtgggagctgccttggcaggagtacttattctagtgttgctggcttattttattggtctc
aagcaccatcatgctggatatgagcaattttag

DBGET integrated database retrieval system