KEGG   Homo sapiens (human): 3929Help
Entry
3929              CDS       T01001                                 

Gene name
LBP, BPIFD2
Definition
(RefSeq) lipopolysaccharide binding protein
  KO
K05399  lipopolysaccharide-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    3929 (LBP)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3929 (LBP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    3929 (LBP)
   05152 Tuberculosis
    3929 (LBP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    3929 (LBP)
   04147 Exosome [BR:hsa04147]
    3929 (LBP)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   3929 (LBP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   3929 (LBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP PHA_gran_rgn
Motif
Other DBs
NCBI-GeneID: 3929
NCBI-ProteinID: NP_004130
OMIM: 151990
HGNC: 6517
Ensembl: ENSG00000129988
Vega: OTTHUMG00000032447
Pharos: P18428(Tbio)
UniProt: P18428 Q8TCF0
LinkDB All DBs
Position
20q11.23
AA seq 481 aa AA seqDB search
MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLP
DFTGDLRIPHVGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRK
SFFKLQGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNL
FHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSFADIDYSLVEAPRATA
QMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLN
FSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDP
YMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFN
AELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMR
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgggggccttggccagagccctgccgtccatactgctggcattgctgcttacgtccacc
ccagaggctctgggtgccaaccccggcttggtcgccaggatcaccgacaagggactgcag
tatgcggcccaggaggggctattagctctgcagagtgagctgctcaggatcacgctgcct
gacttcaccggggacttgaggatcccccacgtcggccgtgggcgctatgagttccacagc
ctgaacatccacagctgtgagctgcttcactctgcgctgaggcctgtccctggccagggc
ctgagtctcagcatctccgactcctccatccgggtccagggcaggtggaaggtgcgcaag
tcattcttcaaactacagggctcctttgatgtcagtgtcaagggcatcagcatttcggtc
aacctcctgttgggcagcgagtcctccgggaggcccacagttactgcctccagctgcagc
agtgacatcgctgacgtggaggtggacatgtcgggagacttggggtggctgttgaacctc
ttccacaaccagattgagtccaagttccagaaagtactggagagcaggatttgcgaaatg
atccagaaatcagtgtcctccgatctacagccttatctccaaactctgccagttacaaca
gagattgacagtttcgccgacattgattatagcttagtggaagcccctcgggcaacagcc
cagatgctggaggtgatgtttaagggtgaaatctttcatcgtaaccaccgttctccagtt
accctccttgctgcagtcatgagccttcctgaggaacacaacaaaatggtctactttgcc
atctcggattatgtcttcaacacggccagcctggtttatcatgaggaaggatatctgaac
ttctccatcacagatgacatgataccgcctgactctaatatccgactgaccaccaagtcc
ttccgacccttcgtcccacggttagccaggctctaccccaacatgaacctggaactccag
ggatcagtgccctctgctccgctcctgaacttcagccctgggaatctgtctgtggacccc
tatatggagatagatgcctttgtgctcctgcccagctccagcaaggagcctgtcttccgg
ctcagtgtggccactaatgtgtccgccaccttgaccttcaataccagcaagatcactggg
ttcctgaagccaggaaaggtaaaagtggaactgaaagaatccaaagttggactattcaat
gcagagctgttggaagcgctcctcaactattacatccttaacaccttctaccccaagttc
aatgataagttggccgaaggcttcccccttcctctgctgaagcgtgttcagctctacgac
cttgggctgcagatccataaggacttcctgttcttgggtgccaatgtccaatacatgaga
gtttga

DBGET integrated database retrieval system