KEGG   Homo sapiens (human): 3948Help
Entry
3948              CDS       T01001                                 

Gene name
LDHC, CT32, LDH3, LDHX
Definition
(RefSeq) lactate dehydrogenase C
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3948 (LDHC)
   00620 Pyruvate metabolism
    3948 (LDHC)
   00640 Propanoate metabolism
    3948 (LDHC)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    3948 (LDHC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    3948 (LDHC)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    3948 (LDHC)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    3948 (LDHC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3948 (LDHC)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     3948 (LDHC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3948 (LDHC)
  Exosomal proteins of breast milk
   3948 (LDHC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4
Motif
Other DBs
NCBI-GeneID: 3948
NCBI-ProteinID: NP_002292
OMIM: 150150
HGNC: 6544
Ensembl: ENSG00000166796
Vega: OTTHUMG00000167722
Pharos: P07864(Tbio)
UniProt: P07864 A0A140VKA7
LinkDB All DBs
Position
11p15.1
AA seq 332 aa AA seqDB search
MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKG
EMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSI
IPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGV
HPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYE
IIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGV
SDVVKINLNSEEEALFKKSAETLWNIQKDLIF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgtcaaggagcagctaattgagaagctaattgaggatgatgaaaactcccag
tgtaaaattactattgttggaactggtgccgtaggcatggcttgtgctattagtatctta
ctgaaggatttggctgatgaacttgcccttgttgatgttgcattggacaaactgaaggga
gaaatgatggatcttcagcatggcagtcttttctttagtacttcaaagattacttctgga
aaagattacagtgtatctgcaaactccagaatagttattgtcacagcaggtgcaaggcag
caggagggagaaactcgccttgccctggtccaacgtaatgtggctataatgaaatcaatc
attcctgccatagtccattatagtcctgattgtaaaattcttgttgtttcaaatccagtg
gatattttgacatatatagtctggaagataagtggcttacctgtaactcgtgtaattgga
agtggttgtaatctagactctgcccgtttccgttacctaattggagaaaagttgggtgtc
caccccacaagctgccatggttggattattggagaacatggtgattctagtgtgccctta
tggagtggggtgaatgttgctggtgttgctctgaagactctggaccctaaattaggaacg
gattcagataaggaacactggaaaaatatccataaacaagttattcaaagtgcctatgaa
attatcaagctgaaggggtatacctcttgggctattggactgtctgtgatggatctggta
ggatccattttgaaaaatcttaggagagtgcacccagtttccaccatggttaagggatta
tatggaataaaagaagaactctttctcagtatcccttgtgtcttggggcggaatggtgtc
tcagatgttgtgaaaattaacttgaattctgaggaggaggcccttttcaagaagagtgca
gaaacactttggaatattcaaaaggatctaatattttaa

DBGET integrated database retrieval system